BLASTX nr result
ID: Anemarrhena21_contig00064499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064499 (254 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007695891.1| hypothetical protein COCSADRAFT_156678 [Bipo... 58 2e-06 ref|XP_007688972.1| hypothetical protein COCMIDRAFT_6205 [Bipola... 57 6e-06 >ref|XP_007695891.1| hypothetical protein COCSADRAFT_156678 [Bipolaris sorokiniana ND90Pr] gi|628215221|ref|XP_007713940.1| hypothetical protein COCCADRAFT_6426 [Bipolaris zeicola 26-R-13] gi|451854934|gb|EMD68226.1| hypothetical protein COCSADRAFT_156678 [Bipolaris sorokiniana ND90Pr] gi|452001096|gb|EMD93556.1| hypothetical protein COCHEDRAFT_1171426 [Bipolaris maydis C5] gi|477589920|gb|ENI06995.1| hypothetical protein COCC4DRAFT_38620 [Bipolaris maydis ATCC 48331] gi|576917533|gb|EUC31753.1| hypothetical protein COCCADRAFT_6426 [Bipolaris zeicola 26-R-13] gi|578485517|gb|EUN23012.1| hypothetical protein COCVIDRAFT_30090 [Bipolaris victoriae FI3] Length = 92 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/44 (65%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -1 Query: 131 MSAIDSATRPSGYMSDS-SDGQASGGRKLTTNIGGVPSSSHLNR 3 MS ++S RP+GY SDS SDGQASGGRK++ N+G VPSS+ LNR Sbjct: 1 MSTMESTIRPTGYGSDSESDGQASGGRKVSANVGPVPSSATLNR 44 >ref|XP_007688972.1| hypothetical protein COCMIDRAFT_6205 [Bipolaris oryzae ATCC 44560] gi|576930934|gb|EUC44505.1| hypothetical protein COCMIDRAFT_6205 [Bipolaris oryzae ATCC 44560] Length = 92 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/44 (63%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -1 Query: 131 MSAIDSATRPSGYMSDS-SDGQASGGRKLTTNIGGVPSSSHLNR 3 MS ++S RP+GY SDS S+GQASGGRK++ N+G VPSS+ LNR Sbjct: 1 MSTMESTIRPTGYGSDSESEGQASGGRKVSANVGPVPSSATLNR 44