BLASTX nr result
ID: Anemarrhena21_contig00064373
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064373 (216 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD31869.1| hypothetical protein CERSUDRAFT_162701, partial [... 54 1e-10 >gb|EMD31869.1| hypothetical protein CERSUDRAFT_162701, partial [Ceriporiopsis subvermispora B] Length = 87 Score = 53.5 bits (127), Expect(2) = 1e-10 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = +1 Query: 73 SQPKYTTRDYNTANAATFPKPFSNGQNAHWPAN*EIHPTKVRLNPRR 213 SQP Y T YNT ATFP PFS+ +N WP + ++H K RL+ R Sbjct: 39 SQPSYATEGYNTPEGATFPLPFSDDRNRCWPVDRKVHQAKARLSSGR 85 Score = 38.9 bits (89), Expect(2) = 1e-10 Identities = 18/29 (62%), Positives = 19/29 (65%), Gaps = 8/29 (27%) Frame = +2 Query: 2 PCFKTGRLKPLRQYKHH--------KACC 64 PCFKTGRLKPLRQ+ H KACC Sbjct: 7 PCFKTGRLKPLRQHPKHERGRTPTIKACC 35