BLASTX nr result
ID: Anemarrhena21_contig00064275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064275 (323 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007325801.1| hypothetical protein AGABI1DRAFT_110685 [Aga... 59 2e-06 ref|XP_006454105.1| hypothetical protein AGABI2DRAFT_189413 [Aga... 57 5e-06 gb|KIK30228.1| hypothetical protein PISMIDRAFT_671378 [Pisolithu... 56 8e-06 >ref|XP_007325801.1| hypothetical protein AGABI1DRAFT_110685 [Agaricus bisporus var. burnettii JB137-S8] gi|409083742|gb|EKM84099.1| hypothetical protein AGABI1DRAFT_110685 [Agaricus bisporus var. burnettii JB137-S8] Length = 656 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/63 (44%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -2 Query: 286 RIETLFSIPAHDVGVTYLDSDGDTITISTQTELNDYLRTA--GNSVKLNVKKLGSSDVQP 113 ++ +LFSIP H V VTY+D+D + IT+ST+ EL DY +++ G+S KL+V+ L + P Sbjct: 30 KVASLFSIPQHQVAVTYVDADDEEITLSTEEELQDYYQSSLPGDSFKLSVRDLSRRNQSP 89 Query: 112 LSP 104 P Sbjct: 90 EQP 92 >ref|XP_006454105.1| hypothetical protein AGABI2DRAFT_189413 [Agaricus bisporus var. bisporus H97] gi|426201199|gb|EKV51122.1| hypothetical protein AGABI2DRAFT_189413 [Agaricus bisporus var. bisporus H97] Length = 657 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/63 (42%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -2 Query: 286 RIETLFSIPAHDVGVTYLDSDGDTITISTQTELNDYLRTA--GNSVKLNVKKLGSSDVQP 113 ++ +LFSIP H V VTY+D++ + IT+ST+ EL DY +++ G+S KL+V+ L + P Sbjct: 30 KVASLFSIPQHQVAVTYVDAEDEEITLSTEEELQDYYQSSLPGDSFKLSVRDLSRRNQSP 89 Query: 112 LSP 104 P Sbjct: 90 EQP 92 >gb|KIK30228.1| hypothetical protein PISMIDRAFT_671378 [Pisolithus microcarpus 441] Length = 785 Score = 56.2 bits (134), Expect = 8e-06 Identities = 34/78 (43%), Positives = 49/78 (62%), Gaps = 5/78 (6%) Frame = -2 Query: 286 RIETLFSIPAHDVGVTYLDSDGDTITISTQTELNDY---LRTAGN--SVKLNVKKLGSSD 122 RI +LF IP VGV+Y+D+DGD IT+S+ EL DY L +G+ ++KL V LGS+ Sbjct: 32 RIASLFDIPGERVGVSYIDADGDEITVSSDEELRDYYASLPASGSPTTIKLTVLDLGSTR 91 Query: 121 VQPLSPEQSIPYQLPSTP 68 V + + P + P+TP Sbjct: 92 VATETSSKPQPTK-PTTP 108