BLASTX nr result
ID: Anemarrhena21_contig00064248
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064248 (277 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001797885.1| hypothetical protein SNOG_07550 [Phaeosphaer... 96 7e-18 ref|XP_007781699.1| hypothetical protein W97_05479 [Coniosporium... 89 1e-15 gb|EUN29965.1| hypothetical protein COCVIDRAFT_91717 [Bipolaris ... 85 2e-14 ref|XP_007706792.1| hypothetical protein COCCADRAFT_81862 [Bipol... 85 2e-14 ref|XP_008021704.1| hypothetical protein SETTUDRAFT_166888 [Seto... 85 2e-14 gb|EMD96111.1| hypothetical protein COCHEDRAFT_1127588 [Bipolari... 85 2e-14 ref|XP_007694154.1| hypothetical protein COCSADRAFT_31924 [Bipol... 85 2e-14 ref|XP_003836478.1| hypothetical protein LEMA_P040140.1 [Leptosp... 84 3e-14 ref|XP_003303748.1| hypothetical protein PTT_16091 [Pyrenophora ... 84 3e-14 ref|XP_007690247.1| hypothetical protein COCMIDRAFT_7328 [Bipola... 81 2e-13 ref|XP_001935957.1| conserved hypothetical protein [Pyrenophora ... 81 2e-13 ref|XP_007588209.1| putative peptidase aspartic protein [Neofusi... 77 6e-12 gb|EKG22569.1| Peptidase A1 [Macrophomina phaseolina MS6] 76 8e-12 gb|KKY24152.1| putative peptidase a1 [Diplodia seriata] 72 1e-10 ref|XP_007587137.1| putative peptidase aspartic protein [Neofusi... 71 2e-10 gb|KIN07270.1| hypothetical protein OIDMADRAFT_150623, partial [... 70 4e-10 gb|EKG13670.1| Peptidase A1 [Macrophomina phaseolina MS6] 69 1e-09 gb|EMR84744.1| putative peptidase aspartic protein [Botrytis cin... 67 6e-09 emb|CCD48686.1| hypothetical protein BofuT4_P033280.1 [Botrytis ... 67 6e-09 gb|KEQ82389.1| acid protease [Aureobasidium pullulans EXF-150] 65 1e-08 >ref|XP_001797885.1| hypothetical protein SNOG_07550 [Phaeosphaeria nodorum SN15] gi|111063896|gb|EAT85016.1| hypothetical protein SNOG_07550 [Phaeosphaeria nodorum SN15] Length = 584 Score = 96.3 bits (238), Expect = 7e-18 Identities = 47/62 (75%), Positives = 51/62 (82%) Frame = -2 Query: 186 MPIAPRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIV 7 M I+PR T+ P PYVVPPSQ FDGNDGSWST KISVGTPGQDFRVL ST+SG QV+V Sbjct: 1 MHISPRDTA-VAPEPYVVPPSQAFDGNDGSWSTFKISVGTPGQDFRVLPSTKSGVIQVVV 59 Query: 6 PD 1 PD Sbjct: 60 PD 61 >ref|XP_007781699.1| hypothetical protein W97_05479 [Coniosporium apollinis CBS 100218] gi|494829801|gb|EON66382.1| hypothetical protein W97_05479 [Coniosporium apollinis CBS 100218] Length = 638 Score = 88.6 bits (218), Expect = 1e-15 Identities = 40/62 (64%), Positives = 48/62 (77%) Frame = -2 Query: 186 MPIAPRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIV 7 M +APRA +TVPAP+V PSQ +DGNDGSWST ++VGTPGQDFRVL ST ET V+ Sbjct: 1 MALAPRAEPTTVPAPFVFTPSQDWDGNDGSWSTFNVNVGTPGQDFRVLISTSGYETWVVA 60 Query: 6 PD 1 P+ Sbjct: 61 PE 62 >gb|EUN29965.1| hypothetical protein COCVIDRAFT_91717 [Bipolaris victoriae FI3] Length = 599 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/62 (64%), Positives = 49/62 (79%) Frame = -2 Query: 186 MPIAPRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIV 7 M +A RAT + PAPY VPPS KFDG DGSWST K+SVG+PGQDFR++ ST++G T VI Sbjct: 1 MSLAARATGA--PAPYTVPPSGKFDGADGSWSTFKVSVGSPGQDFRLIPSTKAGVTYVIA 58 Query: 6 PD 1 P+ Sbjct: 59 PE 60 >ref|XP_007706792.1| hypothetical protein COCCADRAFT_81862 [Bipolaris zeicola 26-R-13] gi|576924908|gb|EUC39015.1| hypothetical protein COCCADRAFT_81862 [Bipolaris zeicola 26-R-13] Length = 599 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/62 (64%), Positives = 49/62 (79%) Frame = -2 Query: 186 MPIAPRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIV 7 M +A RAT + PAPY VPPS KFDG DGSWST K+SVG+PGQDFR++ ST++G T VI Sbjct: 1 MSLAARATGA--PAPYTVPPSGKFDGADGSWSTFKVSVGSPGQDFRLIPSTKAGVTYVIA 58 Query: 6 PD 1 P+ Sbjct: 59 PE 60 >ref|XP_008021704.1| hypothetical protein SETTUDRAFT_166888 [Setosphaeria turcica Et28A] gi|482814358|gb|EOA91036.1| hypothetical protein SETTUDRAFT_166888 [Setosphaeria turcica Et28A] Length = 604 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/63 (65%), Positives = 49/63 (77%), Gaps = 1/63 (1%) Frame = -2 Query: 186 MPIAPRATS-STVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVI 10 M +A RA + S P PY VPPS KFDGNDG+WST K+SVG+PGQDFRVL ST++G T VI Sbjct: 1 MGLAVRAAAPSAAPKPYSVPPSGKFDGNDGTWSTFKLSVGSPGQDFRVLPSTKAGVTYVI 60 Query: 9 VPD 1 P+ Sbjct: 61 APE 63 >gb|EMD96111.1| hypothetical protein COCHEDRAFT_1127588 [Bipolaris maydis C5] gi|477593901|gb|ENI10970.1| hypothetical protein COCC4DRAFT_67873 [Bipolaris maydis ATCC 48331] Length = 599 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/62 (64%), Positives = 49/62 (79%) Frame = -2 Query: 186 MPIAPRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIV 7 M +A RAT + PAPY VPPS KFDG DGSWST K+SVG+PGQDFR++ ST++G T VI Sbjct: 1 MSLAARATGA--PAPYTVPPSGKFDGADGSWSTFKVSVGSPGQDFRLIPSTKAGVTYVIA 58 Query: 6 PD 1 P+ Sbjct: 59 PE 60 >ref|XP_007694154.1| hypothetical protein COCSADRAFT_31924 [Bipolaris sorokiniana ND90Pr] gi|451855869|gb|EMD69160.1| hypothetical protein COCSADRAFT_31924 [Bipolaris sorokiniana ND90Pr] Length = 599 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/62 (64%), Positives = 49/62 (79%) Frame = -2 Query: 186 MPIAPRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIV 7 M +A RAT + PAPY VPPS KFDG DGSWST K+SVG+PGQDFR++ ST++G T VI Sbjct: 1 MSLAARATGA--PAPYTVPPSGKFDGADGSWSTFKVSVGSPGQDFRLIPSTKAGVTYVIA 58 Query: 6 PD 1 P+ Sbjct: 59 PE 60 >ref|XP_003836478.1| hypothetical protein LEMA_P040140.1 [Leptosphaeria maculans JN3] gi|312213031|emb|CBX93113.1| hypothetical protein LEMA_P040140.1 [Leptosphaeria maculans JN3] Length = 623 Score = 84.3 bits (207), Expect = 3e-14 Identities = 37/56 (66%), Positives = 45/56 (80%) Frame = -2 Query: 168 ATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVPD 1 A ++ P P+VVPPSQKFDGNDGSWST +SVGTPGQDFRVL ST+ G T ++ P+ Sbjct: 5 ARATGPPQPFVVPPSQKFDGNDGSWSTFTVSVGTPGQDFRVLPSTKGGVTYLVAPE 60 >ref|XP_003303748.1| hypothetical protein PTT_16091 [Pyrenophora teres f. teres 0-1] gi|311320027|gb|EFQ88145.1| hypothetical protein PTT_16091 [Pyrenophora teres f. teres 0-1] Length = 619 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/59 (66%), Positives = 45/59 (76%) Frame = -2 Query: 177 APRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVPD 1 A RA + P PY+VPPS+KFDG DGSWST ISVGTPGQ FRVL ST+SG T V+ P+ Sbjct: 5 ARRADAPDAPKPYIVPPSKKFDGTDGSWSTFVISVGTPGQQFRVLPSTKSGVTFVVAPE 63 >ref|XP_007690247.1| hypothetical protein COCMIDRAFT_7328 [Bipolaris oryzae ATCC 44560] gi|576929622|gb|EUC43226.1| hypothetical protein COCMIDRAFT_7328 [Bipolaris oryzae ATCC 44560] Length = 599 Score = 81.3 bits (199), Expect = 2e-13 Identities = 36/56 (64%), Positives = 44/56 (78%) Frame = -2 Query: 168 ATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVPD 1 A + PAPY VPPS KFDG DGSWST K+SVG+PGQDFR++ ST++G T VI P+ Sbjct: 5 ARAMGAPAPYTVPPSGKFDGADGSWSTFKVSVGSPGQDFRLIPSTKAGVTYVIAPE 60 >ref|XP_001935957.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187983056|gb|EDU48544.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 617 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/56 (67%), Positives = 43/56 (76%) Frame = -2 Query: 168 ATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVPD 1 A + P PYVVPPS KFDG DGSWST KISVGTP Q+FRVL ST+SG T V+ P+ Sbjct: 5 AQGADAPQPYVVPPSTKFDGPDGSWSTFKISVGTPEQEFRVLPSTKSGVTFVVAPE 60 >ref|XP_007588209.1| putative peptidase aspartic protein [Neofusicoccum parvum UCRNP2] gi|485917288|gb|EOD44319.1| putative peptidase aspartic protein [Neofusicoccum parvum UCRNP2] Length = 553 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -2 Query: 168 ATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVPD 1 ATS+T PAP VP + ++DGNDG WST +I+VGTP QDFRVL ST+ ET V++P+ Sbjct: 2 ATSTTAPAPIAVPATGEWDGNDGDWSTFRIAVGTPPQDFRVLVSTRGHETWVVLPE 57 >gb|EKG22569.1| Peptidase A1 [Macrophomina phaseolina MS6] Length = 538 Score = 76.3 bits (186), Expect = 8e-12 Identities = 38/62 (61%), Positives = 45/62 (72%) Frame = -2 Query: 186 MPIAPRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIV 7 M I PR T TVPAPYVVP + ++DG+DG+WST IS+GTP Q FRVL ST ET V V Sbjct: 1 MAIHPRTT--TVPAPYVVPTTDRWDGSDGAWSTFSISIGTPPQSFRVLVSTLGQETWVPV 58 Query: 6 PD 1 P+ Sbjct: 59 PE 60 >gb|KKY24152.1| putative peptidase a1 [Diplodia seriata] Length = 558 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/57 (57%), Positives = 41/57 (71%) Frame = -2 Query: 171 RATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVPD 1 R VP PY VP + ++DGNDGSWST ++SVGTP Q+FRVL ST+ ET V VP+ Sbjct: 5 RRRDDAVPTPYTVPNTGQWDGNDGSWSTFRLSVGTPPQEFRVLVSTRGHETWVPVPE 61 >ref|XP_007587137.1| putative peptidase aspartic protein [Neofusicoccum parvum UCRNP2] gi|485918912|gb|EOD45409.1| putative peptidase aspartic protein [Neofusicoccum parvum UCRNP2] Length = 549 Score = 71.2 bits (173), Expect = 2e-10 Identities = 33/59 (55%), Positives = 41/59 (69%) Frame = -2 Query: 177 APRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVPD 1 A R P+PY VP + ++DGNDG WST ++SVGTP QDFRVL ST+ ET V VP+ Sbjct: 5 ALRPRQDPAPSPYTVPNTGQWDGNDGQWSTFRLSVGTPPQDFRVLVSTRGHETWVPVPE 63 >gb|KIN07270.1| hypothetical protein OIDMADRAFT_150623, partial [Oidiodendron maius Zn] Length = 478 Score = 70.5 bits (171), Expect = 4e-10 Identities = 34/57 (59%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -2 Query: 171 RATSST-VPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVP 4 RA + T VPAP VVPPSQ +DG+DG+WS+ + VGTP Q+ RVL ST S ET V++P Sbjct: 13 RAENDTQVPAPLVVPPSQYWDGDDGAWSSFALRVGTPAQNVRVLVSTNSPETMVVLP 69 >gb|EKG13670.1| Peptidase A1 [Macrophomina phaseolina MS6] Length = 551 Score = 68.9 bits (167), Expect = 1e-09 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = -2 Query: 186 MPIAPRATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIV 7 MP+ R S +P PY VP + ++DGNDG WS+ ++SVGTP QDFRVL ST+ ET V+ Sbjct: 1 MPLQRREDS--IPQPYTVPTTGEWDGNDGPWSSFRLSVGTPPQDFRVLVSTRGHETFVLD 58 Query: 6 P 4 P Sbjct: 59 P 59 >gb|EMR84744.1| putative peptidase aspartic protein [Botrytis cinerea BcDW1] Length = 802 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -2 Query: 153 VPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVP 4 VP+P V+P SQ FDG+DG WS+L + VG+P QD RVL ST S +T V++P Sbjct: 38 VPSPLVIPASQYFDGDDGEWSSLALRVGSPAQDVRVLVSTNSPQTLVVLP 87 >emb|CCD48686.1| hypothetical protein BofuT4_P033280.1 [Botrytis cinerea T4] Length = 715 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/50 (58%), Positives = 38/50 (76%) Frame = -2 Query: 153 VPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVP 4 VP+P V+P SQ FDG+DG WS+L + VG+P QD RVL ST S +T V++P Sbjct: 38 VPSPLVIPASQYFDGDDGEWSSLALRVGSPAQDVRVLVSTNSPQTLVVLP 87 >gb|KEQ82389.1| acid protease [Aureobasidium pullulans EXF-150] Length = 595 Score = 65.5 bits (158), Expect = 1e-08 Identities = 28/56 (50%), Positives = 40/56 (71%) Frame = -2 Query: 168 ATSSTVPAPYVVPPSQKFDGNDGSWSTLKISVGTPGQDFRVLASTQSGETQVIVPD 1 ++++ +P+P+ PSQ +DGNDGSWS+ + VGTP QDFRV ST ET + VP+ Sbjct: 8 SSATAIPSPFYFAPSQYWDGNDGSWSSFMVRVGTPPQDFRVFPSTFGQETLIPVPE 63