BLASTX nr result
ID: Anemarrhena21_contig00064221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064221 (260 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDB22975.1| hypothetical protein H109_05111 [Trichophyton int... 100 3e-19 ref|XP_003011214.1| C6 transcription factor, putative [Arthroder... 100 3e-19 gb|EZF70461.1| hypothetical protein H105_07272 [Trichophyton sou... 100 3e-19 gb|EZF36235.1| hypothetical protein H101_00274 [Trichophyton int... 100 3e-19 gb|EGE02606.1| fungal specific transcription factor domain-conta... 100 3e-19 gb|EGD94421.1| hypothetical protein TESG_01939 [Trichophyton ton... 100 3e-19 ref|XP_003237863.1| hypothetical protein TERG_02571 [Trichophyto... 100 3e-19 ref|XP_003173112.1| hypothetical protein MGYG_05699 [Microsporum... 100 3e-19 gb|KMU83596.1| hypothetical protein CIHG_01379 [Coccidioides imm... 90 7e-16 ref|XP_001247385.2| C6 transcription factor [Coccidioides immiti... 90 7e-16 gb|KMM65359.1| hypothetical protein CPAG_01710 [Coccidioides pos... 88 2e-15 gb|EFW21899.1| fungal specific transcription factor domain-conta... 88 2e-15 ref|XP_003066001.1| Fungal specific transcription factor, putati... 88 2e-15 ref|XP_007777678.1| hypothetical protein W97_01583 [Coniosporium... 84 3e-14 gb|EYE92025.1| putative fungal-specific transcription factor [As... 81 3e-13 ref|XP_001266405.1| fungal specific transcription factor, putati... 79 9e-13 gb|KMK58896.1| C6 transcription factor [Aspergillus fumigatus Z5] 79 2e-12 ref|XP_001481487.1| C6 transcription factor [Aspergillus fumigat... 79 2e-12 ref|XP_001276412.1| fungal specific transcription factor domain ... 79 2e-12 dbj|GAO84504.1| uncharacterized transcriptional regulatory prote... 78 3e-12 >gb|KDB22975.1| hypothetical protein H109_05111 [Trichophyton interdigitale MR816] Length = 686 Score = 100 bits (250), Expect = 3e-19 Identities = 46/77 (59%), Positives = 56/77 (72%) Frame = -2 Query: 232 VICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCP 53 V+C DT M AWC R+DG++DE LFKAN+L+HTYIVDLHRELSSL Y P Sbjct: 375 VVCSRVDTCMRAWCSLIPPKKRCLAREDGTIDEQLFKANMLVHTYIVDLHRELSSLSYSP 434 Query: 52 IESVSKCAPPPPPESNH 2 IESVS+CAPP P ++N+ Sbjct: 435 IESVSRCAPPAPADANN 451 >ref|XP_003011214.1| C6 transcription factor, putative [Arthroderma benhamiae CBS 112371] gi|302653650|ref|XP_003018648.1| C6 transcription factor, putative [Trichophyton verrucosum HKI 0517] gi|291174763|gb|EFE30574.1| C6 transcription factor, putative [Arthroderma benhamiae CBS 112371] gi|291182307|gb|EFE38003.1| C6 transcription factor, putative [Trichophyton verrucosum HKI 0517] Length = 714 Score = 100 bits (250), Expect = 3e-19 Identities = 46/77 (59%), Positives = 56/77 (72%) Frame = -2 Query: 232 VICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCP 53 V+C DT M AWC R+DG++DE LFKAN+L+HTYIVDLHRELSSL Y P Sbjct: 403 VVCSRVDTCMRAWCSLIPPKKRCLAREDGTIDEQLFKANMLVHTYIVDLHRELSSLSYSP 462 Query: 52 IESVSKCAPPPPPESNH 2 IESVS+CAPP P ++N+ Sbjct: 463 IESVSRCAPPAPADANN 479 >gb|EZF70461.1| hypothetical protein H105_07272 [Trichophyton soudanense CBS 452.61] Length = 685 Score = 100 bits (250), Expect = 3e-19 Identities = 46/77 (59%), Positives = 56/77 (72%) Frame = -2 Query: 232 VICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCP 53 V+C DT M AWC R+DG++DE LFKAN+L+HTYIVDLHRELSSL Y P Sbjct: 374 VVCSRVDTCMRAWCSLIPPKKRCLAREDGTIDEQLFKANMLVHTYIVDLHRELSSLSYSP 433 Query: 52 IESVSKCAPPPPPESNH 2 IESVS+CAPP P ++N+ Sbjct: 434 IESVSRCAPPAPADANN 450 >gb|EZF36235.1| hypothetical protein H101_00274 [Trichophyton interdigitale H6] Length = 690 Score = 100 bits (250), Expect = 3e-19 Identities = 46/77 (59%), Positives = 56/77 (72%) Frame = -2 Query: 232 VICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCP 53 V+C DT M AWC R+DG++DE LFKAN+L+HTYIVDLHRELSSL Y P Sbjct: 375 VVCSRVDTCMRAWCSLIPPKKRCLAREDGTIDEQLFKANMLVHTYIVDLHRELSSLSYSP 434 Query: 52 IESVSKCAPPPPPESNH 2 IESVS+CAPP P ++N+ Sbjct: 435 IESVSRCAPPAPADANN 451 >gb|EGE02606.1| fungal specific transcription factor domain-containing protein [Trichophyton equinum CBS 127.97] Length = 691 Score = 100 bits (250), Expect = 3e-19 Identities = 46/77 (59%), Positives = 56/77 (72%) Frame = -2 Query: 232 VICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCP 53 V+C DT M AWC R+DG++DE LFKAN+L+HTYIVDLHRELSSL Y P Sbjct: 376 VVCSRVDTCMRAWCSLIPPKKRCLAREDGTIDEQLFKANMLVHTYIVDLHRELSSLSYSP 435 Query: 52 IESVSKCAPPPPPESNH 2 IESVS+CAPP P ++N+ Sbjct: 436 IESVSRCAPPAPADANN 452 >gb|EGD94421.1| hypothetical protein TESG_01939 [Trichophyton tonsurans CBS 112818] Length = 691 Score = 100 bits (250), Expect = 3e-19 Identities = 46/77 (59%), Positives = 56/77 (72%) Frame = -2 Query: 232 VICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCP 53 V+C DT M AWC R+DG++DE LFKAN+L+HTYIVDLHRELSSL Y P Sbjct: 376 VVCSRVDTCMRAWCSLIPPKKRCLAREDGTIDEQLFKANMLVHTYIVDLHRELSSLSYSP 435 Query: 52 IESVSKCAPPPPPESNH 2 IESVS+CAPP P ++N+ Sbjct: 436 IESVSRCAPPAPADANN 452 >ref|XP_003237863.1| hypothetical protein TERG_02571 [Trichophyton rubrum CBS 118892] gi|326460861|gb|EGD86314.1| hypothetical protein TERG_02571 [Trichophyton rubrum CBS 118892] gi|607866368|gb|EZF11722.1| hypothetical protein H100_07274 [Trichophyton rubrum MR850] gi|607900941|gb|EZF38607.1| hypothetical protein H102_07234 [Trichophyton rubrum CBS 100081] gi|607912949|gb|EZF49134.1| hypothetical protein H103_07257 [Trichophyton rubrum CBS 288.86] gi|607925038|gb|EZF59779.1| hypothetical protein H104_07210 [Trichophyton rubrum CBS 289.86] gi|607949059|gb|EZF81153.1| hypothetical protein H110_07255 [Trichophyton rubrum MR1448] gi|607961202|gb|EZF91820.1| hypothetical protein H113_07309 [Trichophyton rubrum MR1459] gi|607973447|gb|EZG02723.1| hypothetical protein H106_07094 [Trichophyton rubrum CBS 735.88] gi|607985189|gb|EZG13391.1| hypothetical protein H107_07415 [Trichophyton rubrum CBS 202.88] gi|633055245|gb|KDB30399.1| hypothetical protein H112_07248 [Trichophyton rubrum D6] gi|861299482|gb|KMQ43767.1| Zn(2)-C6 fungal-type DNA-binding domain [Trichophyton rubrum] Length = 685 Score = 100 bits (250), Expect = 3e-19 Identities = 46/77 (59%), Positives = 56/77 (72%) Frame = -2 Query: 232 VICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCP 53 V+C DT M AWC R+DG++DE LFKAN+L+HTYIVDLHRELSSL Y P Sbjct: 374 VVCSRVDTCMRAWCSLIPPKKRCLAREDGTIDEQLFKANMLVHTYIVDLHRELSSLSYSP 433 Query: 52 IESVSKCAPPPPPESNH 2 IESVS+CAPP P ++N+ Sbjct: 434 IESVSRCAPPAPADANN 450 >ref|XP_003173112.1| hypothetical protein MGYG_05699 [Microsporum gypseum CBS 118893] gi|311343498|gb|EFR02701.1| hypothetical protein MGYG_05699 [Microsporum gypseum CBS 118893] Length = 691 Score = 100 bits (250), Expect = 3e-19 Identities = 46/77 (59%), Positives = 56/77 (72%) Frame = -2 Query: 232 VICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCP 53 V+C DT M AWC R+DG++DE LFKAN+L+HTYIVDLHRELSSL Y P Sbjct: 376 VVCSRVDTCMRAWCSLIPPKKRCLAREDGTIDEQLFKANMLVHTYIVDLHRELSSLSYSP 435 Query: 52 IESVSKCAPPPPPESNH 2 IESVS+CAPP P ++N+ Sbjct: 436 IESVSRCAPPAPADANN 452 >gb|KMU83596.1| hypothetical protein CIHG_01379 [Coccidioides immitis H538.4] Length = 555 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/78 (56%), Positives = 50/78 (64%) Frame = -2 Query: 235 KVICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYC 56 + IC D ++AWC R DG+VDE LF ANIL+HT IVDLHRELS L Y Sbjct: 361 RTICAEVDIAISAWCALLPASKKNVKRSDGTVDEQLFNANILIHTCIVDLHRELSDLAYS 420 Query: 55 PIESVSKCAPPPPPESNH 2 PIESVS+CAPP P E H Sbjct: 421 PIESVSRCAPPSPAERLH 438 >ref|XP_001247385.2| C6 transcription factor [Coccidioides immitis RS] gi|767015450|gb|EAS35802.2| C6 transcription factor [Coccidioides immitis RS] gi|859405812|gb|KMP01087.1| hypothetical protein CIRG_01227 [Coccidioides immitis RMSCC 2394] gi|875280604|gb|KMU74332.1| hypothetical protein CISG_04681 [Coccidioides immitis RMSCC 3703] Length = 589 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/78 (56%), Positives = 50/78 (64%) Frame = -2 Query: 235 KVICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYC 56 + IC D ++AWC R DG+VDE LF ANIL+HT IVDLHRELS L Y Sbjct: 361 RTICAEVDIAISAWCALLPASKKNVKRSDGTVDEQLFNANILIHTCIVDLHRELSDLAYS 420 Query: 55 PIESVSKCAPPPPPESNH 2 PIESVS+CAPP P E H Sbjct: 421 PIESVSRCAPPSPAERLH 438 >gb|KMM65359.1| hypothetical protein CPAG_01710 [Coccidioides posadasii RMSCC 3488] Length = 589 Score = 88.2 bits (217), Expect = 2e-15 Identities = 43/78 (55%), Positives = 50/78 (64%) Frame = -2 Query: 235 KVICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYC 56 + IC D ++AWC R DG+VDE LF ANIL+HT IVDLHRELS L Y Sbjct: 361 RTICAEVDIAISAWCALLPASKKNVKRSDGTVDEQLFNANILIHTCIVDLHRELSDLAYS 420 Query: 55 PIESVSKCAPPPPPESNH 2 PIESVS+CAPP P + H Sbjct: 421 PIESVSRCAPPSPAKRLH 438 >gb|EFW21899.1| fungal specific transcription factor domain-containing protein [Coccidioides posadasii str. Silveira] Length = 559 Score = 88.2 bits (217), Expect = 2e-15 Identities = 43/78 (55%), Positives = 50/78 (64%) Frame = -2 Query: 235 KVICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYC 56 + IC D ++AWC R DG+VDE LF ANIL+HT IVDLHRELS L Y Sbjct: 331 RTICAEVDIAISAWCALLPASKKNVKRSDGTVDEQLFNANILIHTCIVDLHRELSDLAYS 390 Query: 55 PIESVSKCAPPPPPESNH 2 PIESVS+CAPP P + H Sbjct: 391 PIESVSRCAPPSPAKRLH 408 >ref|XP_003066001.1| Fungal specific transcription factor, putative [Coccidioides posadasii C735 delta SOWgp] gi|240105663|gb|EER23856.1| Fungal specific transcription factor, putative [Coccidioides posadasii C735 delta SOWgp] Length = 566 Score = 88.2 bits (217), Expect = 2e-15 Identities = 43/78 (55%), Positives = 50/78 (64%) Frame = -2 Query: 235 KVICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYC 56 + IC D ++AWC R DG+VDE LF ANIL+HT IVDLHRELS L Y Sbjct: 338 RTICAEVDIAISAWCALLPASKKNVKRSDGTVDEQLFNANILIHTCIVDLHRELSDLAYS 397 Query: 55 PIESVSKCAPPPPPESNH 2 PIESVS+CAPP P + H Sbjct: 398 PIESVSRCAPPSPAKRLH 415 >ref|XP_007777678.1| hypothetical protein W97_01583 [Coniosporium apollinis CBS 100218] gi|494825143|gb|EON62361.1| hypothetical protein W97_01583 [Coniosporium apollinis CBS 100218] Length = 460 Score = 84.3 bits (207), Expect = 3e-14 Identities = 40/73 (54%), Positives = 48/73 (65%) Frame = -2 Query: 229 ICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCPI 50 IC NAD + AW RDD ++DELLFKAN+L+ Y VD+HR LS+L Y I Sbjct: 207 ICTNADASVAAWLSLLSKSKRKFFRDDRTLDELLFKANMLIQVYTVDIHRSLSTLAYSAI 266 Query: 49 ESVSKCAPPPPPE 11 E+VS CAPPPPPE Sbjct: 267 EAVSSCAPPPPPE 279 >gb|EYE92025.1| putative fungal-specific transcription factor [Aspergillus ruber CBS 135680] Length = 548 Score = 80.9 bits (198), Expect = 3e-13 Identities = 39/75 (52%), Positives = 50/75 (66%) Frame = -2 Query: 235 KVICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYC 56 K +C NADT + AW R DGSVDE++FKA +MHTY V++HR LS+L+Y Sbjct: 320 KSMCANADTSVRAWHALLPISKRRLIRSDGSVDEIMFKALFIMHTYTVEIHRPLSTLEYS 379 Query: 55 PIESVSKCAPPPPPE 11 PIE+VS+CAP P E Sbjct: 380 PIEAVSRCAPLAPSE 394 >ref|XP_001266405.1| fungal specific transcription factor, putative [Neosartorya fischeri NRRL 181] gi|119414569|gb|EAW24508.1| fungal specific transcription factor, putative [Neosartorya fischeri NRRL 181] Length = 442 Score = 79.3 bits (194), Expect = 9e-13 Identities = 37/74 (50%), Positives = 47/74 (63%) Frame = -2 Query: 229 ICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCPI 50 +C N D + +W R DGS+DE+LFKA ++HT+IVDLHR+LS+L Y I Sbjct: 193 VCANVDAIHVSWTTLLPASKRTVFRPDGSLDEILFKARAIIHTWIVDLHRQLSTLAYSAI 252 Query: 49 ESVSKCAPPPPPES 8 E VSKC P PPES Sbjct: 253 EGVSKCCPQAPPES 266 >gb|KMK58896.1| C6 transcription factor [Aspergillus fumigatus Z5] Length = 589 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/74 (50%), Positives = 47/74 (63%) Frame = -2 Query: 229 ICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCPI 50 +C N D + +W R DGS+DE LFKA+ ++HT+IVDLHR+LS+L Y I Sbjct: 340 VCANVDAIHVSWTSLLPASKRTVFRPDGSLDETLFKAHAIIHTWIVDLHRQLSNLAYSAI 399 Query: 49 ESVSKCAPPPPPES 8 E VSKC P PPES Sbjct: 400 EGVSKCCPQAPPES 413 >ref|XP_001481487.1| C6 transcription factor [Aspergillus fumigatus Af293] gi|129556383|gb|EBA27258.1| C6 transcription factor, putative [Aspergillus fumigatus Af293] Length = 589 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/74 (50%), Positives = 47/74 (63%) Frame = -2 Query: 229 ICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELSSLKYCPI 50 +C N D + +W R DGS+DE LFKA+ ++HT+IVDLHR+LS+L Y I Sbjct: 340 VCANVDAIHVSWTSLLPASKRTVFRPDGSLDETLFKAHAIIHTWIVDLHRQLSNLAYSAI 399 Query: 49 ESVSKCAPPPPPES 8 E VSKC P PPES Sbjct: 400 EGVSKCCPQAPPES 413 >ref|XP_001276412.1| fungal specific transcription factor domain protein [Aspergillus clavatus NRRL 1] gi|119404610|gb|EAW14986.1| fungal specific transcription factor domain protein [Aspergillus clavatus NRRL 1] Length = 515 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/81 (45%), Positives = 50/81 (61%) Frame = -2 Query: 250 DHAQAKVICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELS 71 D + N D + +W R DG++DE+LFKAN ++HT+IVDLHR+LS Sbjct: 267 DIKNVTAVSANVDATVASWTSLLPPSKKTVFRPDGTLDEVLFKANAILHTWIVDLHRQLS 326 Query: 70 SLKYCPIESVSKCAPPPPPES 8 +L Y IE+VS CAPP PP+S Sbjct: 327 TLAYSTIEAVSYCAPPAPPDS 347 >dbj|GAO84504.1| uncharacterized transcriptional regulatory protein C530.05 [Neosartorya udagawae] Length = 588 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/81 (45%), Positives = 48/81 (59%) Frame = -2 Query: 250 DHAQAKVICDNADTMMTAWCXXXXXXXXXXXRDDGSVDELLFKANILMHTYIVDLHRELS 71 D +C N D + +W R DGS+DE+LFKA+ ++HT+IVDLHR+LS Sbjct: 334 DMKNINTVCANVDAIHVSWTSLLPPSKKTVFRPDGSLDEILFKAHAIIHTWIVDLHRQLS 393 Query: 70 SLKYCPIESVSKCAPPPPPES 8 +L Y IE VS C P PPES Sbjct: 394 NLAYSAIEGVSYCCPQAPPES 414