BLASTX nr result
ID: Anemarrhena21_contig00064216
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064216 (536 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006290736.1| hypothetical protein CARUB_v10016832mg [Caps... 56 8e-06 >ref|XP_006290736.1| hypothetical protein CARUB_v10016832mg [Capsella rubella] gi|482559443|gb|EOA23634.1| hypothetical protein CARUB_v10016832mg [Capsella rubella] Length = 637 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/74 (44%), Positives = 43/74 (58%), Gaps = 4/74 (5%) Frame = -3 Query: 225 GGGIGERTRL----VHRIARTKAAMSLREEKENQPSIRMRIDRLQSQLPIPEIWTKPHNK 58 G G+ + TRL V R R AM+ RE ENQ S + R+ +LPIPEIW KP + Sbjct: 145 GVGVVDHTRLNEFVVVRTLRDDLAMAQREVAENQASSQPM--RVLEKLPIPEIWQKPESG 202 Query: 57 GYQQCIERPKDKIR 16 Y+QC+ RPK+ R Sbjct: 203 NYRQCVARPKNYTR 216