BLASTX nr result
ID: Anemarrhena21_contig00064215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064215 (290 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001802894.1| hypothetical protein SNOG_12673 [Phaeosphaer... 64 3e-08 ref|XP_007699253.1| hypothetical protein COCSADRAFT_312928 [Bipo... 63 7e-08 ref|XP_007689503.1| hypothetical protein COCMIDRAFT_99341 [Bipol... 62 2e-07 ref|XP_007709538.1| hypothetical protein COCCADRAFT_34434 [Bipol... 62 2e-07 gb|EMD85351.1| hypothetical protein COCHEDRAFT_1161481 [Bipolari... 62 2e-07 ref|XP_003834037.1| similar to FKBP-type peptidyl-prolyl isomera... 60 7e-07 ref|XP_008028225.1| hypothetical protein SETTUDRAFT_92552 [Setos... 59 2e-06 >ref|XP_001802894.1| hypothetical protein SNOG_12673 [Phaeosphaeria nodorum SN15] gi|160703715|gb|EAT79971.2| hypothetical protein SNOG_12673 [Phaeosphaeria nodorum SN15] Length = 124 Score = 64.3 bits (155), Expect = 3e-08 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -1 Query: 107 MGVEKQVLKPGNGTDIPKKHDEVSMAYTGWLFDES 3 MGVEK +L+PGNG D+PKKHDEVSM YTGWL+D++ Sbjct: 1 MGVEKIMLRPGNGIDVPKKHDEVSMEYTGWLYDDN 35 >ref|XP_007699253.1| hypothetical protein COCSADRAFT_312928 [Bipolaris sorokiniana ND90Pr] gi|451851339|gb|EMD64637.1| hypothetical protein COCSADRAFT_312928 [Bipolaris sorokiniana ND90Pr] Length = 124 Score = 63.2 bits (152), Expect = 7e-08 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 107 MGVEKQVLKPGNGTDIPKKHDEVSMAYTGWLFDE 6 MGVEK V KPGNGTD PKKHDE+ + YTGWL+DE Sbjct: 1 MGVEKVVAKPGNGTDFPKKHDEICVEYTGWLYDE 34 >ref|XP_007689503.1| hypothetical protein COCMIDRAFT_99341 [Bipolaris oryzae ATCC 44560] gi|576930430|gb|EUC44012.1| hypothetical protein COCMIDRAFT_99341 [Bipolaris oryzae ATCC 44560] Length = 124 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 107 MGVEKQVLKPGNGTDIPKKHDEVSMAYTGWLFDE 6 MGVEK V KPGNGTD PKKHDE+ + YTGWL+D+ Sbjct: 1 MGVEKIVAKPGNGTDFPKKHDEICVEYTGWLYDD 34 >ref|XP_007709538.1| hypothetical protein COCCADRAFT_34434 [Bipolaris zeicola 26-R-13] gi|576922016|gb|EUC36149.1| hypothetical protein COCCADRAFT_34434 [Bipolaris zeicola 26-R-13] gi|578486918|gb|EUN24384.1| hypothetical protein COCVIDRAFT_106333 [Bipolaris victoriae FI3] Length = 124 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 107 MGVEKQVLKPGNGTDIPKKHDEVSMAYTGWLFDE 6 MGVEK V KPGNGTD PKKHDE+ + YTGWL+D+ Sbjct: 1 MGVEKIVAKPGNGTDFPKKHDEICVEYTGWLYDD 34 >gb|EMD85351.1| hypothetical protein COCHEDRAFT_1161481 [Bipolaris maydis C5] gi|477583083|gb|ENI00185.1| hypothetical protein COCC4DRAFT_151256 [Bipolaris maydis ATCC 48331] Length = 124 Score = 61.6 bits (148), Expect = 2e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -1 Query: 107 MGVEKQVLKPGNGTDIPKKHDEVSMAYTGWLFDE 6 MGVEK V KPGNGTD PKKHDE+ + YTGWL+D+ Sbjct: 1 MGVEKIVAKPGNGTDFPKKHDEICVEYTGWLYDD 34 >ref|XP_003834037.1| similar to FKBP-type peptidyl-prolyl isomerase [Leptosphaeria maculans JN3] gi|312210586|emb|CBX90672.1| similar to FKBP-type peptidyl-prolyl isomerase [Leptosphaeria maculans JN3] Length = 124 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = -1 Query: 107 MGVEKQVLKPGNGTDIPKKHDEVSMAYTGWLFDE 6 M VEK V++PGNG D PKK+DEVSM YTGWLFDE Sbjct: 1 MVVEKAVIRPGNGIDTPKKNDEVSMEYTGWLFDE 34 >ref|XP_008028225.1| hypothetical protein SETTUDRAFT_92552 [Setosphaeria turcica Et28A] gi|482806661|gb|EOA83713.1| hypothetical protein SETTUDRAFT_92552 [Setosphaeria turcica Et28A] Length = 168 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = -1 Query: 107 MGVEKQVLKPGNGTDIPKKHDEVSMAYTGWLFDE 6 MGVEK V +PGNGTD PKK+DE+ + YTGWL+D+ Sbjct: 1 MGVEKTVARPGNGTDFPKKNDEICVEYTGWLYDD 34