BLASTX nr result
ID: Anemarrhena21_contig00064093
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064093 (231 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001799034.1| hypothetical protein SNOG_08724 [Phaeosphaer... 59 1e-06 >ref|XP_001799034.1| hypothetical protein SNOG_08724 [Phaeosphaeria nodorum SN15] gi|111062772|gb|EAT83892.1| hypothetical protein SNOG_08724 [Phaeosphaeria nodorum SN15] Length = 1369 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 10 EDSEGKPFIIVDDPPTHGGFRADKDDEGYANE 105 ED+EGKPFI+VDDP GGFRAD+DDEGYA+E Sbjct: 1337 EDAEGKPFILVDDPDPRGGFRADQDDEGYADE 1368