BLASTX nr result
ID: Anemarrhena21_contig00064081
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064081 (207 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum... 55 1e-07 gb|EAS50136.1| hypothetical protein SI859A1_01496 [Aurantimonas ... 52 1e-06 >emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] gi|566555979|emb|CDK99198.1| protein of unknown function [Magnetospirillum gryphiswaldense MSR-1 v2] Length = 259 Score = 55.1 bits (131), Expect(2) = 1e-07 Identities = 26/42 (61%), Positives = 30/42 (71%) Frame = -2 Query: 164 VSGLRHATCRPVRTRFRYGSTFRLNLATHRNSQAHYAKGTRS 39 VSGL HAT RP++TRFR T+RL LA + NS HY KGT S Sbjct: 38 VSGLMHATRRPIQTRFRCAYTYRLKLAAYTNSLTHYTKGTPS 79 Score = 26.9 bits (58), Expect(2) = 1e-07 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 204 VTAPSTWPWIDH 169 VT PST PWIDH Sbjct: 25 VTPPSTCPWIDH 36 >gb|EAS50136.1| hypothetical protein SI859A1_01496 [Aurantimonas manganoxydans SI85-9A1] Length = 100 Score = 52.0 bits (123), Expect(2) = 1e-06 Identities = 26/42 (61%), Positives = 28/42 (66%) Frame = -2 Query: 164 VSGLRHATCRPVRTRFRYGSTFRLNLATHRNSQAHYAKGTRS 39 VSGL T RPV+TRFRY ST+RL LA S HY KGT S Sbjct: 16 VSGLIRRTERPVQTRFRYASTYRLKLARQTKSLTHYTKGTMS 57 Score = 26.9 bits (58), Expect(2) = 1e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = -1 Query: 207 RVTAPSTWPWIDH 169 RVTAPST W+DH Sbjct: 2 RVTAPSTCSWLDH 14