BLASTX nr result
ID: Anemarrhena21_contig00064075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00064075 (571 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EKG13297.1| Calcium/proton exchanger [Macrophomina phaseolina... 63 8e-08 ref|XP_007582374.1| putative calcium proton exchanger protein [N... 63 1e-07 ref|XP_007674630.1| hypothetical protein BAUCODRAFT_66859 [Baudo... 62 2e-07 ref|XP_007782238.1| calcium/proton exchanger [Coniosporium apoll... 61 3e-07 ref|XP_003296766.1| hypothetical protein PTT_06946 [Pyrenophora ... 61 3e-07 ref|XP_001931979.1| vacuolar calcium ion transporter /H(+) excha... 60 5e-07 ref|XP_001804633.1| hypothetical protein SNOG_14447 [Phaeosphaer... 60 7e-07 gb|KKY25867.1| putative vacuolar calcium ion transporter h(+) ex... 59 2e-06 dbj|GAM87851.1| hypothetical protein ANO11243_058790 [fungal sp.... 59 2e-06 gb|KIW73786.1| calcium/proton exchanger, variant 1 [Capronia sem... 57 4e-06 gb|KIW73785.1| calcium/proton exchanger [Capronia semiimmersa] 57 4e-06 gb|EUN24052.1| hypothetical protein COCVIDRAFT_18528 [Bipolaris ... 57 4e-06 ref|XP_007711284.1| hypothetical protein COCCADRAFT_4239 [Bipola... 57 4e-06 ref|XP_008020758.1| hypothetical protein SETTUDRAFT_178102 [Seto... 57 4e-06 ref|XP_007704408.1| hypothetical protein COCSADRAFT_100429 [Bipo... 57 4e-06 ref|XP_003834890.1| similar to vacuolar calcium ion transporter ... 57 4e-06 ref|XP_007752457.1| Ca2+:H+ antiporter [Cladophialophora yegresi... 57 6e-06 gb|EMD97884.1| hypothetical protein COCHEDRAFT_1125870 [Bipolari... 56 1e-05 >gb|EKG13297.1| Calcium/proton exchanger [Macrophomina phaseolina MS6] Length = 442 Score = 63.2 bits (152), Expect = 8e-08 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDITPGDFFGNVFS 126 SNYLEGAMC+GTY IIALAF+VYPDDA GDIT DFF N+ + Sbjct: 403 SNYLEGAMCIGTYIIIALAFFVYPDDA-GDIT--DFFRNLIA 441 >ref|XP_007582374.1| putative calcium proton exchanger protein [Neofusicoccum parvum UCRNP2] gi|485925609|gb|EOD50132.1| putative calcium proton exchanger protein [Neofusicoccum parvum UCRNP2] Length = 446 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDITPGDFFGNV 120 SNYLEGAMC+GTY IIALAF+VYPDDA GDIT DFF N+ Sbjct: 405 SNYLEGAMCIGTYIIIALAFFVYPDDA-GDIT--DFFRNM 441 >ref|XP_007674630.1| hypothetical protein BAUCODRAFT_66859 [Baudoinia compniacensis UAMH 10762] gi|449301772|gb|EMC97781.1| hypothetical protein BAUCODRAFT_66859 [Baudoinia compniacensis UAMH 10762] Length = 417 Score = 61.6 bits (148), Expect = 2e-07 Identities = 32/43 (74%), Positives = 33/43 (76%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDITPGDFFGNVFSR 129 SNYLEGAMCLGTY IIA+AFYVYPDDA GDI G N F R Sbjct: 378 SNYLEGAMCLGTYIIIAIAFYVYPDDA-GDI--GSMVSNFFGR 417 >ref|XP_007782238.1| calcium/proton exchanger [Coniosporium apollinis CBS 100218] gi|494830357|gb|EON66921.1| calcium/proton exchanger [Coniosporium apollinis CBS 100218] Length = 437 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMCLGTY IIALAFYVYPDDA GDIT Sbjct: 400 SNYLEGAMCLGTYIIIALAFYVYPDDA-GDIT 430 >ref|XP_003296766.1| hypothetical protein PTT_06946 [Pyrenophora teres f. teres 0-1] gi|311330949|gb|EFQ95137.1| hypothetical protein PTT_06946 [Pyrenophora teres f. teres 0-1] Length = 424 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMC+G Y IIALAFY+YPDDA+G+IT Sbjct: 382 SNYLEGAMCIGIYAIIALAFYIYPDDAEGNIT 413 >ref|XP_001931979.1| vacuolar calcium ion transporter /H(+) exchanger [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187973585|gb|EDU41084.1| vacuolar calcium ion transporter /H(+) exchanger [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 425 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMC+G Y IIALAFY+YPDDA G+IT Sbjct: 383 SNYLEGAMCIGIYAIIALAFYIYPDDAAGNIT 414 >ref|XP_001804633.1| hypothetical protein SNOG_14447 [Phaeosphaeria nodorum SN15] gi|160704776|gb|EAT78318.2| hypothetical protein SNOG_14447 [Phaeosphaeria nodorum SN15] Length = 440 Score = 60.1 bits (144), Expect = 7e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDITPGDFFGNVFSR 129 SNYLEGAMC+G Y IIALAFY+YPD+A G++ P F + F R Sbjct: 398 SNYLEGAMCIGIYAIIALAFYIYPDNANGELGP-KFIASFFER 439 >gb|KKY25867.1| putative vacuolar calcium ion transporter h(+) exchanger [Diplodia seriata] Length = 435 Score = 58.9 bits (141), Expect = 2e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMC+GTY IIALAF+VYPDDA GDIT Sbjct: 393 SNYLEGAMCIGTYIIIALAFFVYPDDA-GDIT 423 >dbj|GAM87851.1| hypothetical protein ANO11243_058790 [fungal sp. No.11243] Length = 425 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/41 (70%), Positives = 31/41 (75%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDITPGDFFGNVF 123 SNYLEG MCLGTYTIIALAFY+YPDDA GD N+F Sbjct: 388 SNYLEGCMCLGTYTIIALAFYIYPDDA------GDPIMNLF 422 >gb|KIW73786.1| calcium/proton exchanger, variant 1 [Capronia semiimmersa] gi|759297373|gb|KIW73787.1| calcium/proton exchanger, variant 2 [Capronia semiimmersa] Length = 431 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDITPGDFFGNVFSRG 132 SNYLEG +CLG Y IIALAFYV PDDA I G ++F RG Sbjct: 387 SNYLEGLLCLGMYAIIALAFYVLPDDAGSGINLGSGLASLFGRG 430 >gb|KIW73785.1| calcium/proton exchanger [Capronia semiimmersa] Length = 452 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDITPGDFFGNVFSRG 132 SNYLEG +CLG Y IIALAFYV PDDA I G ++F RG Sbjct: 408 SNYLEGLLCLGMYAIIALAFYVLPDDAGSGINLGSGLASLFGRG 451 >gb|EUN24052.1| hypothetical protein COCVIDRAFT_18528 [Bipolaris victoriae FI3] Length = 424 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMC+ Y IIALAFY+YPDDA G IT Sbjct: 382 SNYLEGAMCIAIYAIIALAFYIYPDDAAGTIT 413 >ref|XP_007711284.1| hypothetical protein COCCADRAFT_4239 [Bipolaris zeicola 26-R-13] gi|576920244|gb|EUC34404.1| hypothetical protein COCCADRAFT_4239 [Bipolaris zeicola 26-R-13] Length = 424 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMC+ Y IIALAFY+YPDDA G IT Sbjct: 382 SNYLEGAMCIAIYAIIALAFYIYPDDAAGTIT 413 >ref|XP_008020758.1| hypothetical protein SETTUDRAFT_178102 [Setosphaeria turcica Et28A] gi|482814954|gb|EOA91629.1| hypothetical protein SETTUDRAFT_178102 [Setosphaeria turcica Et28A] Length = 447 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMC+ Y IIALAFY+YPDDA G IT Sbjct: 405 SNYLEGAMCIAIYAIIALAFYIYPDDAAGTIT 436 >ref|XP_007704408.1| hypothetical protein COCSADRAFT_100429 [Bipolaris sorokiniana ND90Pr] gi|451846915|gb|EMD60224.1| hypothetical protein COCSADRAFT_100429 [Bipolaris sorokiniana ND90Pr] Length = 424 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMC+ Y IIALAFY+YPDDA G IT Sbjct: 382 SNYLEGAMCIAIYAIIALAFYIYPDDAAGTIT 413 >ref|XP_003834890.1| similar to vacuolar calcium ion transporter /H(+) exchanger [Leptosphaeria maculans JN3] gi|312211440|emb|CBX91525.1| similar to vacuolar calcium ion transporter /H(+) exchanger [Leptosphaeria maculans JN3] Length = 423 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMC+G Y IIALAFY+YPDDA IT Sbjct: 381 SNYLEGAMCIGIYAIIALAFYIYPDDAASHIT 412 >ref|XP_007752457.1| Ca2+:H+ antiporter [Cladophialophora yegresii CBS 114405] gi|589980649|gb|EXJ63890.1| Ca2+:H+ antiporter [Cladophialophora yegresii CBS 114405] Length = 460 Score = 57.0 bits (136), Expect = 6e-06 Identities = 26/44 (59%), Positives = 31/44 (70%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDITPGDFFGNVFSRG 132 SNYLEG +CLG Y IIALAFYV PDDA + G+ G++F G Sbjct: 416 SNYLEGLLCLGMYAIIALAFYVLPDDAGNGLNLGNSLGSLFGGG 459 >gb|EMD97884.1| hypothetical protein COCHEDRAFT_1125870 [Bipolaris maydis C5] gi|477585632|gb|ENI02719.1| hypothetical protein COCC4DRAFT_52009 [Bipolaris maydis ATCC 48331] Length = 424 Score = 56.2 bits (134), Expect = 1e-05 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = +1 Query: 1 SNYLEGAMCLGTYTIIALAFYVYPDDAKGDIT 96 SNYLEGAMC+ Y IIALAFY+YPD+A G+IT Sbjct: 382 SNYLEGAMCIAIYAIIALAFYIYPDNAAGNIT 413