BLASTX nr result
ID: Anemarrhena21_contig00063997
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063997 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KLU88300.1| hypothetical protein MAPG_07287 [Magnaporthiopsis... 58 2e-06 gb|EQB45561.1| integral membrane protein [Colletotrichum gloeosp... 58 2e-06 ref|XP_007280282.1| integral membrane protein [Colletotrichum gl... 58 2e-06 gb|ENH85967.1| integral membrane protein [Colletotrichum orbicul... 58 3e-06 emb|CCF41435.1| integral membrane protein [Colletotrichum higgin... 58 3e-06 dbj|GAM42621.1| hypothetical protein TCE0_044f16767 [Talaromyces... 57 4e-06 ref|XP_007596527.1| integral membrane protein [Colletotrichum fi... 57 4e-06 ref|XP_008091337.1| integral membrane protein [Colletotrichum gr... 57 4e-06 gb|KDN71271.1| putative integral membrane protein [Colletotrichu... 56 8e-06 >gb|KLU88300.1| hypothetical protein MAPG_07287 [Magnaporthiopsis poae ATCC 64411] Length = 363 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/65 (41%), Positives = 40/65 (61%) Frame = -2 Query: 211 CVIGILMVKYGGAGRHIEYILLTDPNKMVYRTKLDKVLEYTYAISVMCPKLAIVHLYLRV 32 C +G++M + GG G+H+EY+ DP+K+ + E Y S+ PK+AIV LYLRV Sbjct: 84 CAMGLIMTRVGGVGQHVEYLEEHDPSKLTGWAQCILAFELIYFTSMSLPKMAIVFLYLRV 143 Query: 31 FSDRG 17 + RG Sbjct: 144 LNWRG 148 >gb|EQB45561.1| integral membrane protein [Colletotrichum gloeosporioides Cg-14] Length = 403 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = -2 Query: 211 CVIGILMVKYGGAGRHIEYILLTDPNKMVYRTKLDKVLEYTYAISVMCPKLAIVHLYLRV 32 C +GI+MV+ GG GRH+E++ P +V K E Y SV PK+ IV LYLRV Sbjct: 78 CAVGIVMVRVGGVGRHVEFVEEFHPALLVGWAKCILAFEIVYFASVALPKMGIVCLYLRV 137 Query: 31 FSDRG 17 F+ +G Sbjct: 138 FNWKG 142 >ref|XP_007280282.1| integral membrane protein [Colletotrichum gloeosporioides Nara gc5] gi|429855737|gb|ELA30680.1| integral membrane protein [Colletotrichum gloeosporioides Nara gc5] Length = 403 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = -2 Query: 211 CVIGILMVKYGGAGRHIEYILLTDPNKMVYRTKLDKVLEYTYAISVMCPKLAIVHLYLRV 32 C +GI+MV+ GG GRH+E++ P +V K E Y SV PK+ IV LYLRV Sbjct: 78 CAVGIVMVRVGGVGRHVEFVEEFHPALLVGWAKCILAFEIVYFASVALPKMGIVCLYLRV 137 Query: 31 FSDRG 17 F+ +G Sbjct: 138 FNWKG 142 >gb|ENH85967.1| integral membrane protein [Colletotrichum orbiculare MAFF 240422] Length = 404 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/65 (44%), Positives = 38/65 (58%) Frame = -2 Query: 211 CVIGILMVKYGGAGRHIEYILLTDPNKMVYRTKLDKVLEYTYAISVMCPKLAIVHLYLRV 32 C IGI+MV+ GG GRH+E++ P + K E Y SV PK+ IV LYLRV Sbjct: 77 CAIGIVMVRVGGVGRHVEFVEEVHPALLAGWAKCILAFEIVYFASVALPKMGIVCLYLRV 136 Query: 31 FSDRG 17 F+ +G Sbjct: 137 FNWKG 141 >emb|CCF41435.1| integral membrane protein [Colletotrichum higginsianum] Length = 410 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/65 (44%), Positives = 38/65 (58%) Frame = -2 Query: 211 CVIGILMVKYGGAGRHIEYILLTDPNKMVYRTKLDKVLEYTYAISVMCPKLAIVHLYLRV 32 C +GI+MVK GG GRH+E++ P + K E Y SV PK+ IV LYLRV Sbjct: 77 CAVGIVMVKVGGVGRHVEFVEEFHPALLAGWAKCILAFEIVYFASVALPKMGIVCLYLRV 136 Query: 31 FSDRG 17 F+ +G Sbjct: 137 FNWKG 141 >dbj|GAM42621.1| hypothetical protein TCE0_044f16767 [Talaromyces cellulolyticus] Length = 325 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/69 (47%), Positives = 41/69 (59%), Gaps = 1/69 (1%) Frame = -2 Query: 205 IGILMVKYGGAGRHIEYILLTDPNKMVYRTKLDKVLEYTYAISVMCPKLAIVHLYLRVFS 26 +GIL VK GG GRH+EY + DP +V KL Y +V PK++I+ LYLRVF Sbjct: 70 VGILSVKIGGDGRHVEYWDIHDPTVIVTWRKLQTSSGLLYMAAVTFPKVSILVLYLRVFM 129 Query: 25 DRG-RIYRW 2 DR RI W Sbjct: 130 DRKVRIATW 138 >ref|XP_007596527.1| integral membrane protein [Colletotrichum fioriniae PJ7] gi|588898929|gb|EXF79861.1| integral membrane protein [Colletotrichum fioriniae PJ7] Length = 408 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/65 (44%), Positives = 38/65 (58%) Frame = -2 Query: 211 CVIGILMVKYGGAGRHIEYILLTDPNKMVYRTKLDKVLEYTYAISVMCPKLAIVHLYLRV 32 C +GI+MVK GG GRH+E++ P + K E Y SV PK+ IV LYLRV Sbjct: 76 CAVGIVMVKVGGVGRHVEFVEEFHPALLTGWAKCILAFEIIYFTSVALPKMGIVCLYLRV 135 Query: 31 FSDRG 17 F+ +G Sbjct: 136 FNWKG 140 >ref|XP_008091337.1| integral membrane protein [Colletotrichum graminicola M1.001] gi|310791790|gb|EFQ27317.1| integral membrane protein [Colletotrichum graminicola M1.001] Length = 410 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/65 (44%), Positives = 39/65 (60%) Frame = -2 Query: 211 CVIGILMVKYGGAGRHIEYILLTDPNKMVYRTKLDKVLEYTYAISVMCPKLAIVHLYLRV 32 C +GI+MVK GG GRH+EY+ P + K E Y SV PK++IV L+LRV Sbjct: 79 CAVGIVMVKVGGVGRHVEYLEEFHPELLAGWAKSLLAFELIYFTSVALPKMSIVCLFLRV 138 Query: 31 FSDRG 17 F+ +G Sbjct: 139 FNWKG 143 >gb|KDN71271.1| putative integral membrane protein [Colletotrichum sublineola] Length = 409 Score = 56.2 bits (134), Expect = 8e-06 Identities = 28/65 (43%), Positives = 39/65 (60%) Frame = -2 Query: 211 CVIGILMVKYGGAGRHIEYILLTDPNKMVYRTKLDKVLEYTYAISVMCPKLAIVHLYLRV 32 C +GI+MVK GG GRH+E++ P + K E Y SV PK++IV L+LRV Sbjct: 79 CAVGIVMVKVGGVGRHVEFLEEFHPELLAGWAKSLLAFEIVYFTSVALPKMSIVCLFLRV 138 Query: 31 FSDRG 17 F+ +G Sbjct: 139 FNWKG 143