BLASTX nr result
ID: Anemarrhena21_contig00063912
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063912 (234 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003300269.1| hypothetical protein PTT_11465 [Pyrenophora ... 60 6e-07 >ref|XP_003300269.1| hypothetical protein PTT_11465 [Pyrenophora teres f. teres 0-1] gi|311325677|gb|EFQ91633.1| hypothetical protein PTT_11465 [Pyrenophora teres f. teres 0-1] Length = 113 Score = 60.1 bits (144), Expect = 6e-07 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = -3 Query: 97 GADVANIGQCPKDCWNESAAQANCDPNSDDAC 2 G VAN+G CP DCWN++AA ANCDPN+DD C Sbjct: 48 GGSVANVGPCPMDCWNQAAATANCDPNADDKC 79