BLASTX nr result
ID: Anemarrhena21_contig00063896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063896 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001800001.1| hypothetical protein SNOG_09715 [Phaeosphaer... 60 4e-07 >ref|XP_001800001.1| hypothetical protein SNOG_09715 [Phaeosphaeria nodorum SN15] gi|160702666|gb|EAT82980.2| hypothetical protein SNOG_09715 [Phaeosphaeria nodorum SN15] Length = 571 Score = 60.5 bits (145), Expect = 4e-07 Identities = 38/87 (43%), Positives = 48/87 (55%), Gaps = 6/87 (6%) Frame = -1 Query: 283 HHPLVSRNSGR-LPTSSSNT-----RRKETLIRQTFTPQPALRNQALRXXXXXXXXXXXX 122 HHPLVSR + R LPTSSS+T +RK+ R + PQ +LR+Q LR Sbjct: 484 HHPLVSRTTERRLPTSSSSTQHREMKRKDATYRTYYNPQASLRHQKLRSNSSCASQSTKK 543 Query: 121 XKRSAGSGRNFWDMXXXXXXXXVLAGE 41 KRS+ S RN+WD+ VLAGE Sbjct: 544 SKRSSNSARNYWDLGGSVGSGSVLAGE 570