BLASTX nr result
ID: Anemarrhena21_contig00063613
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063613 (228 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIK59772.1| hypothetical protein GYMLUDRAFT_168876 [Gymnopus ... 78 3e-12 ref|XP_008083600.1| hypothetical protein GLAREA_00651 [Glarea lo... 78 3e-12 ref|XP_003035201.1| hypothetical protein SCHCODRAFT_50913 [Schiz... 78 3e-12 ref|XP_007843695.1| plasma membrane proteolipid 3 [Moniliophthor... 77 3e-12 gb|KEQ59816.1| UPF0057-domain-containing protein [Aureobasidium ... 76 8e-12 ref|XP_012745712.1| plasma membrane proteolipid 3 [Pseudogymnoas... 76 8e-12 gb|EHK39638.1| hypothetical protein TRIATDRAFT_253690 [Trichoder... 76 8e-12 ref|XP_006968507.1| predicted protein [Trichoderma reesei QM6a] ... 76 8e-12 ref|XP_003050880.1| predicted protein [Nectria haematococca mpVI... 76 8e-12 gb|KIJ34665.1| hypothetical protein M422DRAFT_181886 [Sphaerobol... 76 1e-11 ref|XP_011319169.1| hypothetical protein FGSG_10222 [Fusarium gr... 76 1e-11 ref|XP_007263965.1| UPF0057-domain-containing protein [Fomitipor... 76 1e-11 gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxyspor... 76 1e-11 ref|XP_007408476.1| hypothetical protein MELLADRAFT_55694 [Melam... 76 1e-11 emb|CEJ91660.1| Putative Plasma membrane proteolipid 3 [Torrubie... 75 1e-11 gb|KFA66992.1| hypothetical protein S40285_06252 [Stachybotrys c... 75 2e-11 gb|KFA45948.1| hypothetical protein S40293_07299 [Stachybotrys c... 75 2e-11 ref|XP_007598233.1| plasma membrane proteolipid 3 [Colletotrichu... 75 2e-11 ref|XP_008099078.1| hypothetical protein GLRG_10202 [Colletotric... 75 2e-11 ref|XP_007338654.1| UPF0057-domain-containing protein [Auricular... 74 3e-11 >gb|KIK59772.1| hypothetical protein GYMLUDRAFT_168876 [Gymnopus luxurians FD-317 M1] Length = 57 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGC ADFCINILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCNADFCINILLTILGYIPGIIHALYIILKY 57 >ref|XP_008083600.1| hypothetical protein GLAREA_00651 [Glarea lozoyensis ATCC 20868] gi|361132095|gb|EHL03710.1| putative Plasma membrane proteolipid 3 [Glarea lozoyensis 74030] gi|512200659|gb|EPE29491.1| hypothetical protein GLAREA_00651 [Glarea lozoyensis ATCC 20868] Length = 57 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGAD CINILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADLCINILLTILGYIPGIIHALYIILKY 57 >ref|XP_003035201.1| hypothetical protein SCHCODRAFT_50913 [Schizophyllum commune H4-8] gi|300108897|gb|EFJ00299.1| hypothetical protein SCHCODRAFT_50913 [Schizophyllum commune H4-8] Length = 57 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGC ADFCINILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCNADFCINILLTILGYIPGIIHALYIILKY 57 >ref|XP_007843695.1| plasma membrane proteolipid 3 [Moniliophthora roreri MCA 2997] gi|554915795|gb|ESK96863.1| plasma membrane proteolipid 3 [Moniliophthora roreri MCA 2997] Length = 57 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADFCINILLTILG++PGIIHALYIILKY Sbjct: 21 GVFLERGCGADFCINILLTILGWLPGIIHALYIILKY 57 >gb|KEQ59816.1| UPF0057-domain-containing protein [Aureobasidium melanogenum CBS 110374] Length = 57 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFLINILLTILGYIPGIIHALYIILKY 57 >ref|XP_012745712.1| plasma membrane proteolipid 3 [Pseudogymnoascus destructans 20631-21] gi|440635359|gb|ELR05278.1| plasma membrane proteolipid 3 [Pseudogymnoascus destructans 20631-21] Length = 57 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFLINILLTILGYIPGIIHALYIILKY 57 >gb|EHK39638.1| hypothetical protein TRIATDRAFT_253690 [Trichoderma atroviride IMI 206040] Length = 57 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFLINILLTILGYIPGIIHALYIILKY 57 >ref|XP_006968507.1| predicted protein [Trichoderma reesei QM6a] gi|340515326|gb|EGR45581.1| predicted protein [Trichoderma reesei QM6a] gi|572275412|gb|ETR98847.1| UPF0057-domain-containing protein [Trichoderma reesei RUT C-30] Length = 57 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFLINILLTILGYIPGIIHALYIILKY 57 >ref|XP_003050880.1| predicted protein [Nectria haematococca mpVI 77-13-4] gi|256731818|gb|EEU45167.1| predicted protein [Nectria haematococca mpVI 77-13-4] Length = 57 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFLINILLTILGYIPGIIHALYIILKY 57 >gb|KIJ34665.1| hypothetical protein M422DRAFT_181886 [Sphaerobolus stellatus SS14] Length = 57 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 57 >ref|XP_011319169.1| hypothetical protein FGSG_10222 [Fusarium graminearum PH-1] gi|410516918|sp|Q4HXT6.2|PMP3_GIBZE RecName: Full=Plasma membrane proteolipid 3 gi|558866824|gb|ESU16907.1| hypothetical protein FGSG_10222 [Fusarium graminearum PH-1] gi|596545806|gb|EYB25849.1| hypothetical protein FG05_10222 [Fusarium graminearum] gi|699044605|emb|CEF75592.1| unnamed protein product [Fusarium graminearum] Length = 57 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 57 >ref|XP_007263965.1| UPF0057-domain-containing protein [Fomitiporia mediterranea MF3/22] gi|393220333|gb|EJD05819.1| UPF0057-domain-containing protein [Fomitiporia mediterranea MF3/22] Length = 57 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 57 >gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxysporum Fo5176] gi|517317170|emb|CCT69344.1| probable RIC1 protein [Fusarium fujikuroi IMI 58289] gi|584131311|gb|EWG40705.1| plasma membrane proteolipid 3 [Fusarium verticillioides 7600] gi|587668050|gb|EWY90391.1| plasma membrane proteolipid 3 [Fusarium oxysporum FOSC 3-a] gi|587690392|gb|EWZ36997.1| plasma membrane proteolipid 3 [Fusarium oxysporum Fo47] gi|587719003|gb|EWZ90340.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587746858|gb|EXA44574.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. pisi HDV247] gi|590037174|gb|EXK39032.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. melonis 26406] gi|590063000|gb|EXK90524.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. raphani 54005] gi|591421327|gb|EXL56464.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591452771|gb|EXL85065.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591470692|gb|EXM01996.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591503744|gb|EXM33089.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|829110287|gb|KLO86824.1| putative RIC1 protein [Fusarium fujikuroi] gi|829112645|gb|KLO89093.1| Uncharacterized protein LW93_12514 [Fusarium fujikuroi] gi|829142269|gb|KLP14054.1| Uncharacterized protein LW94_7022 [Fusarium fujikuroi] Length = 57 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFFINILLTILGYIPGIIHALYIILKY 57 >ref|XP_007408476.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 98AG31] gi|328859168|gb|EGG08278.1| hypothetical protein MELLADRAFT_55694 [Melampsora larici-populina 98AG31] Length = 57 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGYIPGIIHALYIILKY Sbjct: 21 GVFLERGCGADFWINILLTILGYIPGIIHALYIILKY 57 >emb|CEJ91660.1| Putative Plasma membrane proteolipid 3 [Torrubiella hemipterigena] Length = 57 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GV LERGCGAD CINILLTILGYIPGIIHALYIILKY Sbjct: 21 GVLLERGCGADLCINILLTILGYIPGIIHALYIILKY 57 >gb|KFA66992.1| hypothetical protein S40285_06252 [Stachybotrys chlorohalonata IBT 40285] Length = 57 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGY+PGIIHALYIILKY Sbjct: 21 GVFLERGCGADFFINILLTILGYLPGIIHALYIILKY 57 >gb|KFA45948.1| hypothetical protein S40293_07299 [Stachybotrys chartarum IBT 40293] gi|667735267|gb|KFA74625.1| hypothetical protein S40288_05814 [Stachybotrys chartarum IBT 40288] Length = 81 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGY+PGIIHALYIILKY Sbjct: 45 GVFLERGCGADFFINILLTILGYLPGIIHALYIILKY 81 >ref|XP_007598233.1| plasma membrane proteolipid 3 [Colletotrichum fioriniae PJ7] gi|380488434|emb|CCF37378.1| plasma membrane proteolipid 3 [Colletotrichum higginsianum] gi|588896715|gb|EXF78143.1| plasma membrane proteolipid 3 [Colletotrichum fioriniae PJ7] gi|666406799|gb|KEY72023.1| hypothetical protein S7711_00042 [Stachybotrys chartarum IBT 7711] Length = 57 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGY+PGIIHALYIILKY Sbjct: 21 GVFLERGCGADFFINILLTILGYLPGIIHALYIILKY 57 >ref|XP_008099078.1| hypothetical protein GLRG_10202 [Colletotrichum graminicola M1.001] gi|310800165|gb|EFQ35058.1| hypothetical protein GLRG_10202 [Colletotrichum graminicola M1.001] gi|530463481|gb|EQB46149.1| hypothetical protein CGLO_14841 [Colletotrichum gloeosporioides Cg-14] gi|640924637|gb|KDN68644.1| hypothetical protein CSUB01_03103 [Colletotrichum sublineola] Length = 57 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVFLERGCGADF INILLTILGY+PGIIHALYIILKY Sbjct: 21 GVFLERGCGADFFINILLTILGYLPGIIHALYIILKY 57 >ref|XP_007338654.1| UPF0057-domain-containing protein [Auricularia delicata TFB-10046 SS5] gi|393245561|gb|EJD53071.1| UPF0057-domain-containing protein [Auricularia delicata TFB-10046 SS5] Length = 57 Score = 74.3 bits (181), Expect = 3e-11 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 228 GVFLERGCGADFCINILLTILGYIPGIIHALYIILKY 118 GVF ERGCGADF INILLT+LGYIPGIIHALYIILKY Sbjct: 21 GVFFERGCGADFLINILLTVLGYIPGIIHALYIILKY 57