BLASTX nr result
ID: Anemarrhena21_contig00063564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063564 (246 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003304502.1| hypothetical protein PTT_17126 [Pyrenophora ... 100 5e-19 ref|XP_001933289.1| zinc finger protein 740 [Pyrenophora tritici... 100 5e-19 ref|XP_008031240.1| hypothetical protein SETTUDRAFT_35656 [Setos... 93 8e-17 ref|XP_001794476.1| hypothetical protein SNOG_03932 [Phaeosphaer... 92 1e-16 gb|EUN26146.1| hypothetical protein COCVIDRAFT_27458 [Bipolaris ... 85 2e-14 ref|XP_007693029.1| hypothetical protein COCMIDRAFT_30615 [Bipol... 85 2e-14 ref|XP_007712851.1| hypothetical protein COCCADRAFT_97631 [Bipol... 85 2e-14 ref|XP_007702083.1| hypothetical protein COCSADRAFT_38658 [Bipol... 82 2e-13 ref|XP_003840613.1| hypothetical protein LEMA_P102650.1 [Leptosp... 79 1e-12 gb|EMD85078.1| hypothetical protein COCHEDRAFT_1149369 [Bipolari... 79 2e-12 ref|XP_001594995.1| hypothetical protein SS1G_04803 [Sclerotinia... 60 7e-07 gb|ESZ98261.1| hypothetical protein SBOR_1357 [Sclerotinia borea... 59 1e-06 ref|XP_001549958.1| hypothetical protein BC1G_11850 [Botrytis ci... 59 2e-06 ref|XP_008080644.1| C2H2 and C2HC zinc finger [Glarea lozoyensis... 56 8e-06 >ref|XP_003304502.1| hypothetical protein PTT_17126 [Pyrenophora teres f. teres 0-1] gi|311318840|gb|EFQ87411.1| hypothetical protein PTT_17126 [Pyrenophora teres f. teres 0-1] Length = 622 Score = 100 bits (248), Expect = 5e-19 Identities = 46/65 (70%), Positives = 55/65 (84%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 QPNVF+QGGMTESP+P+SPGQQE HRLGAP+ S+PG RSPSLS +H Q++ R GRG+ Sbjct: 437 QPNVFAQGGMTESPRPLSPGQQEQHRLGAPENSLPGSRSPSLSHHIHQQNYAR--GRGTP 494 Query: 63 PIGLA 49 PIGLA Sbjct: 495 PIGLA 499 >ref|XP_001933289.1| zinc finger protein 740 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978853|gb|EDU45479.1| zinc finger protein 740 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 575 Score = 100 bits (248), Expect = 5e-19 Identities = 46/65 (70%), Positives = 55/65 (84%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 QPNVF+QGGMTESP+P+SPGQQE HRLGAP+ S+PG RSPSLS +H Q++ R GRG+ Sbjct: 390 QPNVFAQGGMTESPRPLSPGQQEQHRLGAPENSLPGSRSPSLSHHIHQQNYAR--GRGTP 447 Query: 63 PIGLA 49 PIGLA Sbjct: 448 PIGLA 452 >ref|XP_008031240.1| hypothetical protein SETTUDRAFT_35656 [Setosphaeria turcica Et28A] gi|482803607|gb|EOA80732.1| hypothetical protein SETTUDRAFT_35656 [Setosphaeria turcica Et28A] Length = 622 Score = 92.8 bits (229), Expect = 8e-17 Identities = 43/65 (66%), Positives = 52/65 (80%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 Q NVF+QGGMTESP+P+SPGQQE HRLGAP+ S+ G RSPSLS MH Q++ R GRG+ Sbjct: 435 QSNVFAQGGMTESPRPLSPGQQEQHRLGAPESSLSGSRSPSLSHHMHQQNYAR--GRGTP 492 Query: 63 PIGLA 49 P+ LA Sbjct: 493 PVSLA 497 >ref|XP_001794476.1| hypothetical protein SNOG_03932 [Phaeosphaeria nodorum SN15] gi|160706082|gb|EAT89137.2| hypothetical protein SNOG_03932 [Phaeosphaeria nodorum SN15] Length = 477 Score = 92.4 bits (228), Expect = 1e-16 Identities = 42/65 (64%), Positives = 50/65 (76%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 Q NVF+QGGMTESPKP+SP QQE HRLG D S+PG RSP++S + HQ RGAGRG+ Sbjct: 288 QSNVFAQGGMTESPKPLSPRQQEQHRLGTRDNSLPGSRSPNMSHHILHQGLARGAGRGTP 347 Query: 63 PIGLA 49 P+ LA Sbjct: 348 PMALA 352 >gb|EUN26146.1| hypothetical protein COCVIDRAFT_27458 [Bipolaris victoriae FI3] Length = 619 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 Q NVF QGGMTESP+P+SPGQQE HRL AP+ ++PG RSPSLS MH Q++ R G G+ Sbjct: 434 QSNVFGQGGMTESPRPLSPGQQEQHRL-APESNMPGSRSPSLSHHMHQQNYAR--GHGTP 490 Query: 63 PIGLA 49 P+ LA Sbjct: 491 PVSLA 495 >ref|XP_007693029.1| hypothetical protein COCMIDRAFT_30615 [Bipolaris oryzae ATCC 44560] gi|576926723|gb|EUC40455.1| hypothetical protein COCMIDRAFT_30615 [Bipolaris oryzae ATCC 44560] Length = 617 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 Q NVF QGGMTESP+P+SPGQQE HRL AP+ ++PG RSPSLS MH Q++ R G G+ Sbjct: 437 QSNVFGQGGMTESPRPLSPGQQEQHRL-APESNMPGSRSPSLSHHMHQQNYAR--GHGTP 493 Query: 63 PIGLA 49 P+ LA Sbjct: 494 PVSLA 498 >ref|XP_007712851.1| hypothetical protein COCCADRAFT_97631 [Bipolaris zeicola 26-R-13] gi|576918634|gb|EUC32825.1| hypothetical protein COCCADRAFT_97631 [Bipolaris zeicola 26-R-13] Length = 619 Score = 85.1 bits (209), Expect = 2e-14 Identities = 41/65 (63%), Positives = 50/65 (76%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 Q NVF QGGMTESP+P+SPGQQE HRL AP+ ++PG RSPSLS MH Q++ R G G+ Sbjct: 434 QSNVFGQGGMTESPRPLSPGQQEQHRL-APESNMPGSRSPSLSHHMHQQNYAR--GHGTP 490 Query: 63 PIGLA 49 P+ LA Sbjct: 491 PVSLA 495 >ref|XP_007702083.1| hypothetical protein COCSADRAFT_38658 [Bipolaris sorokiniana ND90Pr] gi|451848553|gb|EMD61858.1| hypothetical protein COCSADRAFT_38658 [Bipolaris sorokiniana ND90Pr] Length = 622 Score = 81.6 bits (200), Expect = 2e-13 Identities = 40/65 (61%), Positives = 48/65 (73%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 Q NVF Q MTESP+P+SPGQQE HRL APD ++PG RSPSLS MH Q++ R G G+ Sbjct: 437 QSNVFGQSSMTESPRPLSPGQQEQHRL-APDSNMPGSRSPSLSHHMHQQNYVR--GHGTP 493 Query: 63 PIGLA 49 P+ LA Sbjct: 494 PVSLA 498 >ref|XP_003840613.1| hypothetical protein LEMA_P102650.1 [Leptosphaeria maculans JN3] gi|312217185|emb|CBX97134.1| hypothetical protein LEMA_P102650.1 [Leptosphaeria maculans JN3] Length = 998 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/65 (58%), Positives = 47/65 (72%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 Q NVF+ G MTESPKP+SPGQQEH RLGAP+ ++ G RSPS+SQ M+ G RG+ Sbjct: 816 QSNVFAHGSMTESPKPLSPGQQEHRRLGAPEANMHGSRSPSISQHMY------GRARGTP 869 Query: 63 PIGLA 49 P+ LA Sbjct: 870 PMALA 874 >gb|EMD85078.1| hypothetical protein COCHEDRAFT_1149369 [Bipolaris maydis C5] gi|477582145|gb|ENH99258.1| hypothetical protein COCC4DRAFT_85335 [Bipolaris maydis ATCC 48331] Length = 622 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/65 (58%), Positives = 47/65 (72%) Frame = -1 Query: 243 QPNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSS 64 Q NVF Q MTESP+P+SPGQ E HRL AP+ ++PG RSPSLS MH Q++ R G G+ Sbjct: 437 QSNVFGQSSMTESPRPLSPGQHEQHRL-APESNMPGSRSPSLSHHMHQQNYAR--GHGTP 493 Query: 63 PIGLA 49 P+ LA Sbjct: 494 PVSLA 498 >ref|XP_001594995.1| hypothetical protein SS1G_04803 [Sclerotinia sclerotiorum 1980] gi|154702588|gb|EDO02327.1| hypothetical protein SS1G_04803 [Sclerotinia sclerotiorum 1980 UF-70] Length = 346 Score = 59.7 bits (143), Expect = 7e-07 Identities = 30/63 (47%), Positives = 37/63 (58%) Frame = -1 Query: 237 NVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSSPI 58 ++FSQ GMTESPKP+SP H+LG SI RSPSL+ Q Q F R S P Sbjct: 99 SMFSQSGMTESPKPLSPAAMHSHQLGHDSASITRQRSPSLTTQFQQQHFGRHQSGRSPPP 158 Query: 57 GLA 49 G++ Sbjct: 159 GMS 161 >gb|ESZ98261.1| hypothetical protein SBOR_1357 [Sclerotinia borealis F-4157] Length = 712 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/63 (47%), Positives = 37/63 (58%) Frame = -1 Query: 237 NVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSSPI 58 ++FSQ GMTESPKP+SP H+LG SI RSPSL+ Q Q F R S P Sbjct: 493 SMFSQSGMTESPKPLSPAGMHSHQLGHDSASITRQRSPSLTTQFQQQHFGRHQSGRSPPP 552 Query: 57 GLA 49 G++ Sbjct: 553 GMS 555 >ref|XP_001549958.1| hypothetical protein BC1G_11850 [Botrytis cinerea B05.10] gi|347840266|emb|CCD54838.1| similar to transcription factor Zn, C2H2 [Botrytis cinerea T4] gi|472235863|gb|EMR80815.1| putative zinc finger protein crol gamma protein [Botrytis cinerea BcDW1] Length = 711 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/63 (47%), Positives = 37/63 (58%) Frame = -1 Query: 237 NVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSSPI 58 ++FSQ GMTESPKP+SP H+LG SI RSPSL+ Q Q F R S P Sbjct: 496 SMFSQSGMTESPKPLSPAGMHSHQLGHDSTSITRQRSPSLTTQFQQQHFGRHQSGRSPPP 555 Query: 57 GLA 49 G++ Sbjct: 556 GMS 558 >ref|XP_008080644.1| C2H2 and C2HC zinc finger [Glarea lozoyensis ATCC 20868] gi|512203808|gb|EPE32632.1| C2H2 and C2HC zinc finger [Glarea lozoyensis ATCC 20868] Length = 707 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/63 (49%), Positives = 37/63 (58%) Frame = -1 Query: 240 PNVFSQGGMTESPKPISPGQQEHHRLGAPDGSIPGPRSPSLSQQMHHQSFPRGAGRGSSP 61 P++FSQ GMTESPKP+SPG H+LGA RSPSL+ Q Q F R S P Sbjct: 501 PSMFSQSGMTESPKPLSPGGMLAHQLGADQSG--RQRSPSLTTQFQQQHFGRHNSGRSPP 558 Query: 60 IGL 52 G+ Sbjct: 559 PGV 561