BLASTX nr result
ID: Anemarrhena21_contig00063557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063557 (326 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ64397.1| mitochondrial-processing peptidase-like protein s... 57 4e-06 ref|XP_007674026.1| hypothetical protein BAUCODRAFT_154638 [Baud... 57 6e-06 ref|XP_003841355.1| similar to mitochondrial-processing peptidas... 56 8e-06 ref|XP_001801860.1| hypothetical protein SNOG_11621 [Phaeosphaer... 56 8e-06 >gb|KEQ64397.1| mitochondrial-processing peptidase-like protein subunit beta [Aureobasidium melanogenum CBS 110374] Length = 480 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 WDRDIAISAVGQIEGLLTYDRVRGDMSRMFS 94 WDRDIAISAVGQIEGLL Y R+RGDM+RM S Sbjct: 450 WDRDIAISAVGQIEGLLDYSRIRGDMTRMLS 480 >ref|XP_007674026.1| hypothetical protein BAUCODRAFT_154638 [Baudoinia compniacensis UAMH 10762] gi|449302936|gb|EMC98944.1| hypothetical protein BAUCODRAFT_154638 [Baudoinia compniacensis UAMH 10762] Length = 483 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +2 Query: 2 WDRDIAISAVGQIEGLLTYDRVRGDMSRMFS 94 WDRDIAISAVGQIEGLL Y R+RGDM+RM S Sbjct: 453 WDRDIAISAVGQIEGLLDYARIRGDMARMLS 483 >ref|XP_003841355.1| similar to mitochondrial-processing peptidase subunit beta [Leptosphaeria maculans JN3] gi|312217929|emb|CBX97876.1| similar to mitochondrial-processing peptidase subunit beta [Leptosphaeria maculans JN3] Length = 481 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 WDRDIAISAVGQIEGLLTYDRVRGDMSRMFS 94 WDRDIA+SAVGQIEGLL Y+R+R DMSRM S Sbjct: 451 WDRDIAVSAVGQIEGLLDYNRIRNDMSRMLS 481 >ref|XP_001801860.1| hypothetical protein SNOG_11621 [Phaeosphaeria nodorum SN15] gi|160703283|gb|EAT81329.2| hypothetical protein SNOG_11621 [Phaeosphaeria nodorum SN15] Length = 441 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +2 Query: 2 WDRDIAISAVGQIEGLLTYDRVRGDMSRMFS 94 WDRD+AISAVGQIEGLL Y+R+R DMSRM S Sbjct: 411 WDRDVAISAVGQIEGLLDYNRIRNDMSRMLS 441