BLASTX nr result
ID: Anemarrhena21_contig00063521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063521 (370 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007782465.1| hypothetical protein W97_06401 [Coniosporium... 72 1e-10 gb|EKG18472.1| ATPase F0 complex subunit G mitochondrial [Macrop... 69 9e-10 ref|XP_007580147.1| putative mitochondrial f1f0-atp synthase g p... 65 2e-08 dbj|GAM90743.1| hypothetical protein ANO11243_087880 [fungal sp.... 61 3e-07 ref|XP_008711566.1| hypothetical protein HMPREF1541_01043 [Cyphe... 61 3e-07 dbj|GAD99201.1| mitochondrial F1F0-ATP synthase g subunit [Bysso... 60 4e-07 gb|KMQ41945.1| ATPase, F0 complex, subunit G, mitochondrial [Tri... 60 7e-07 gb|KIW02280.1| hypothetical protein PV09_06430 [Verruconis gallo... 60 7e-07 ref|XP_003231270.1| hypothetical protein TERG_08056 [Trichophyto... 60 7e-07 gb|KEQ77577.1| P-loop containing nucleoside triphosphate hydrola... 59 1e-06 ref|XP_003069040.1| Mitochondrial ATP synthase g subunit family ... 59 1e-06 ref|XP_001243617.1| mitochondrial F1F0-ATP synthase G subunit [C... 59 1e-06 ref|XP_003024315.1| hypothetical protein TRV_01513 [Trichophyton... 59 1e-06 ref|XP_003011542.1| hypothetical protein ARB_02095 [Arthroderma ... 59 1e-06 ref|XP_003171116.1| ATP synthase subunit G [Microsporum gypseum ... 59 1e-06 ref|XP_002849994.1| ATP synthase subunit g [Arthroderma otae CBS... 59 1e-06 gb|KEQ79435.1| P-loop containing nucleoside triphosphate hydrola... 59 2e-06 gb|KEQ67306.1| mitochondrial F1F0-ATP synthase-like protein g su... 59 2e-06 gb|EQL34780.1| hypothetical protein BDFG_03477 [Blastomyces derm... 59 2e-06 gb|EEQ89616.1| mitochondrial F1F0-ATP synthase g subunit [Blasto... 59 2e-06 >ref|XP_007782465.1| hypothetical protein W97_06401 [Coniosporium apollinis CBS 100218] gi|494830623|gb|EON67148.1| hypothetical protein W97_06401 [Coniosporium apollinis CBS 100218] Length = 205 Score = 72.4 bits (176), Expect = 1e-10 Identities = 48/122 (39%), Positives = 58/122 (47%) Frame = +3 Query: 3 ASRAVLRHSTFAVRRAGIRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLTRVTXXXXXX 182 ASRAVLRHS FA RRAG+RN GLTRV+ Sbjct: 5 ASRAVLRHSPFAARRAGLRNASTIPDATGSIKPKTSQATSKASE----GLTRVSSSAGGM 60 Query: 183 XXXXXXXXXXXXXXXXXXXXRTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPD 362 RTGR+IG +QSLIPPT+YY +V LE++K V RKMSPP Sbjct: 61 VSRLGGAVSSIGG-------RTGRMIGFVQSLIPPTMYYGRVGLELAKMVFEARKMSPPS 113 Query: 363 VA 368 ++ Sbjct: 114 MS 115 >gb|EKG18472.1| ATPase F0 complex subunit G mitochondrial [Macrophomina phaseolina MS6] Length = 193 Score = 69.3 bits (168), Expect = 9e-10 Identities = 46/119 (38%), Positives = 54/119 (45%) Frame = +3 Query: 3 ASRAVLRHSTFAVRRAGIRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLTRVTXXXXXX 182 ASRAVLRHS FAVRR +RN GL+R + Sbjct: 5 ASRAVLRHSRFAVRRPAVRNASNTTEAAKERASQATSKAAE-------GLSRASASGSAA 57 Query: 183 XXXXXXXXXXXXXXXXXXXXRTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPP 359 RT ++ G IQSLIPPTVYYS+VALE+ K V + RKMSPP Sbjct: 58 LQRASQFGGAALQRLASAGGRTAKVAGFIQSLIPPTVYYSRVALELGKIVFQARKMSPP 116 >ref|XP_007580147.1| putative mitochondrial f1f0-atp synthase g protein [Neofusicoccum parvum UCRNP2] gi|485928731|gb|EOD52380.1| putative mitochondrial f1f0-atp synthase g protein [Neofusicoccum parvum UCRNP2] Length = 193 Score = 65.1 bits (157), Expect = 2e-08 Identities = 43/119 (36%), Positives = 53/119 (44%) Frame = +3 Query: 3 ASRAVLRHSTFAVRRAGIRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLTRVTXXXXXX 182 ASR VLRHS FAVRR +R+ GL+R + Sbjct: 5 ASRQVLRHSRFAVRRPAVRHASSTSEAAKEKAAQASSKAAE-------GLSRASAQGSAA 57 Query: 183 XXXXXXXXXXXXXXXXXXXXRTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPP 359 RT ++ G +QSLIPPTVYYS+VALE+ K V + RKMSPP Sbjct: 58 LQRASQFGGAALQRLASAGGRTAKVAGFVQSLIPPTVYYSRVALELGKIVFQARKMSPP 116 >dbj|GAM90743.1| hypothetical protein ANO11243_087880 [fungal sp. No.11243] Length = 216 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RTG+ + +QSL+PPT+YYSKV LE+++ V R R MSPPDVA Sbjct: 90 RTGKAVSFVQSLVPPTIYYSKVGLELARLVARGRSMSPPDVA 131 >ref|XP_008711566.1| hypothetical protein HMPREF1541_01043 [Cyphellophora europaea CBS 101466] gi|568124269|gb|ETN46854.1| hypothetical protein HMPREF1541_01043 [Cyphellophora europaea CBS 101466] Length = 199 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RTGRLI ++SLIPPT+YYS+V LE++KF ++ +KM+PP VA Sbjct: 79 RTGRLISFVESLIPPTIYYSRVGLELAKFTIQGQKMAPPSVA 120 >dbj|GAD99201.1| mitochondrial F1F0-ATP synthase g subunit [Byssochlamys spectabilis No. 5] Length = 197 Score = 60.5 bits (145), Expect = 4e-07 Identities = 42/122 (34%), Positives = 56/122 (45%) Frame = +3 Query: 3 ASRAVLRHSTFAVRRAGIRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLTRVTXXXXXX 182 ASRAVLR S F +RR +R+ GL+RVT Sbjct: 5 ASRAVLRQSQFMIRRTAVRHSSSSSEAANKAKESASNAASKAQQ----GLSRVTSSAGPA 60 Query: 183 XXXXXXXXXXXXXXXXXXXXRTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPD 362 RTG++I I +LIPPTVYYSKV +E++K V R +KM+PP+ Sbjct: 61 IAGAASNVGSALRKVGG---RTGKVIAYIDTLIPPTVYYSKVGIELAKLVFRGQKMTPPN 117 Query: 363 VA 368 +A Sbjct: 118 LA 119 >gb|KMQ41945.1| ATPase, F0 complex, subunit G, mitochondrial [Trichophyton rubrum] Length = 196 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RT +L+ ++SLIPPT+YYS+V LE+SK V R +KM+PPD+A Sbjct: 78 RTAKLVAFVESLIPPTIYYSRVGLELSKIVFRGQKMAPPDIA 119 >gb|KIW02280.1| hypothetical protein PV09_06430 [Verruconis gallopava] Length = 180 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPP 359 RTGRLIG + SLIPPT+YYSKVALE++K V RE+K++ P Sbjct: 69 RTGRLIGFVSSLIPPTIYYSKVALELAKIVAREQKIAVP 107 >ref|XP_003231270.1| hypothetical protein TERG_08056 [Trichophyton rubrum CBS 118892] gi|326466386|gb|EGD91839.1| hypothetical protein TERG_08056 [Trichophyton rubrum CBS 118892] gi|607882946|gb|EZF27599.1| hypothetical protein H100_00440 [Trichophyton rubrum MR850] gi|607909714|gb|EZF46634.1| hypothetical protein H102_00440 [Trichophyton rubrum CBS 100081] gi|607921751|gb|EZF57269.1| hypothetical protein H103_00440 [Trichophyton rubrum CBS 288.86] gi|607933817|gb|EZF67894.1| hypothetical protein H104_00430 [Trichophyton rubrum CBS 289.86] gi|607945707|gb|EZF78512.1| hypothetical protein H105_00429 [Trichophyton soudanense CBS 452.61] gi|607957806|gb|EZF89149.1| hypothetical protein H110_00444 [Trichophyton rubrum MR1448] gi|607970069|gb|EZG00006.1| hypothetical protein H113_00444 [Trichophyton rubrum MR1459] gi|607981870|gb|EZG10736.1| hypothetical protein H106_00323 [Trichophyton rubrum CBS 735.88] gi|607994053|gb|EZG21524.1| hypothetical protein H107_00481 [Trichophyton rubrum CBS 202.88] gi|633064237|gb|KDB38398.1| hypothetical protein H112_00441 [Trichophyton rubrum D6] Length = 208 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RT +L+ ++SLIPPT+YYS+V LE+SK V R +KM+PPD+A Sbjct: 90 RTAKLVAFVESLIPPTIYYSRVGLELSKIVFRGQKMAPPDIA 131 >gb|KEQ77577.1| P-loop containing nucleoside triphosphate hydrolase protein [Aureobasidium namibiae CBS 147.97] Length = 850 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDV 365 RTG++I +QS+IPPTVYY KV LE++K V R +KMSPP+V Sbjct: 76 RTGQVISMVQSMIPPTVYYGKVGLELAKLVARGQKMSPPNV 116 >ref|XP_003069040.1| Mitochondrial ATP synthase g subunit family protein [Coccidioides posadasii C735 delta SOWgp] gi|240108721|gb|EER26895.1| Mitochondrial ATP synthase g subunit family protein [Coccidioides posadasii C735 delta SOWgp] gi|320036790|gb|EFW18728.1| mitochondrial F1F0-ATP synthase g subunit [Coccidioides posadasii str. Silveira] gi|855538277|gb|KMM72365.1| hypothetical protein CPAG_08660 [Coccidioides posadasii RMSCC 3488] Length = 195 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RTGR++ ++SLIPPT+YYS+VA EV+K V +KM+PP+VA Sbjct: 78 RTGRMVSFVESLIPPTIYYSRVAFEVTKIVFHAQKMAPPNVA 119 >ref|XP_001243617.1| mitochondrial F1F0-ATP synthase G subunit [Coccidioides immitis RS] gi|767022024|gb|EAS32034.3| mitochondrial F1F0-ATP synthase G subunit [Coccidioides immitis RS] gi|859413631|gb|KMP07223.1| hypothetical protein CIRG_06904 [Coccidioides immitis RMSCC 2394] gi|875634577|gb|KMU82298.1| hypothetical protein CIHG_00082 [Coccidioides immitis H538.4] Length = 195 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RTGR++ ++SLIPPT+YYS+VA EV+K V +KM+PP+VA Sbjct: 78 RTGRMVSFVESLIPPTIYYSRVAFEVTKIVFHAQKMAPPNVA 119 >ref|XP_003024315.1| hypothetical protein TRV_01513 [Trichophyton verrucosum HKI 0517] gi|291188365|gb|EFE43704.1| hypothetical protein TRV_01513 [Trichophyton verrucosum HKI 0517] Length = 196 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RT +L+ ++SLIPPT+YYS+V LE+SK V R +KM+PPD+A Sbjct: 78 RTAKLVAFVESLIPPTIYYSRVGLELSKIVFRGQKMAPPDMA 119 >ref|XP_003011542.1| hypothetical protein ARB_02095 [Arthroderma benhamiae CBS 112371] gi|291175094|gb|EFE30902.1| hypothetical protein ARB_02095 [Arthroderma benhamiae CBS 112371] gi|326471769|gb|EGD95778.1| mitochondrial F1F0-ATP synthase g subunit [Trichophyton tonsurans CBS 112818] gi|326484926|gb|EGE08936.1| hypothetical protein TEQG_07891 [Trichophyton equinum CBS 127.97] gi|607892810|gb|EZF32098.1| hypothetical protein H101_04311 [Trichophyton interdigitale H6] gi|633042876|gb|KDB20425.1| hypothetical protein H109_07621 [Trichophyton interdigitale MR816] Length = 196 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RT +L+ ++SLIPPT+YYS+V LE+SK V R +KM+PPD+A Sbjct: 78 RTAKLVAFVESLIPPTIYYSRVGLELSKIVFRGQKMAPPDMA 119 >ref|XP_003171116.1| ATP synthase subunit G [Microsporum gypseum CBS 118893] gi|311344905|gb|EFR04108.1| ATP synthase subunit G [Microsporum gypseum CBS 118893] Length = 196 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RT +L+ ++SLIPPT+YYS+V LE+SK V R +KM+PPD+A Sbjct: 78 RTAKLVAFVESLIPPTIYYSRVGLELSKIVFRGQKMAPPDMA 119 >ref|XP_002849994.1| ATP synthase subunit g [Arthroderma otae CBS 113480] gi|238837548|gb|EEQ27210.1| ATP synthase subunit g [Arthroderma otae CBS 113480] Length = 196 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/42 (59%), Positives = 35/42 (83%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RT +L+ ++SLIPPT+YYS+V LE+SK V R +KM+PPD+A Sbjct: 78 RTAKLVAFVESLIPPTIYYSRVGLELSKIVFRGQKMAPPDMA 119 >gb|KEQ79435.1| P-loop containing nucleoside triphosphate hydrolase protein [Aureobasidium pullulans EXF-150] Length = 852 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDV 365 RTG++I +QS+IPPTVYY KV LE++K V R +KMSPP+V Sbjct: 76 RTGQVISFVQSMIPPTVYYGKVGLELAKIVARGQKMSPPNV 116 >gb|KEQ67306.1| mitochondrial F1F0-ATP synthase-like protein g subunit [Aureobasidium melanogenum CBS 110374] Length = 191 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/41 (63%), Positives = 34/41 (82%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDV 365 RTG++I +QS+IPPTVYY KV LE++K V R +KMSPP+V Sbjct: 76 RTGQVISFVQSMIPPTVYYGKVGLELAKLVARGQKMSPPNV 116 >gb|EQL34780.1| hypothetical protein BDFG_03477 [Blastomyces dermatitidis ATCC 26199] Length = 199 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RTGR I + SLIPPT+YYS+V LE+SK V R + MSPP VA Sbjct: 78 RTGRFIAFVDSLIPPTIYYSRVGLELSKIVFRGQNMSPPSVA 119 >gb|EEQ89616.1| mitochondrial F1F0-ATP synthase g subunit [Blastomyces dermatitidis ER-3] Length = 199 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +3 Query: 243 RTGRLIGRIQSLIPPTVYYSKVALEVSKFVVRERKMSPPDVA 368 RTGR I + SLIPPT+YYS+V LE+SK V R + MSPP VA Sbjct: 78 RTGRFIAFVDSLIPPTIYYSRVGLELSKIVFRGQNMSPPSVA 119