BLASTX nr result
ID: Anemarrhena21_contig00063321
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063321 (236 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESA17060.1| hypothetical protein GLOINDRAFT_22168 [Rhizophagu... 99 1e-18 >gb|ESA17060.1| hypothetical protein GLOINDRAFT_22168 [Rhizophagus irregularis DAOM 181602] gi|595452240|gb|EXX59615.1| hypothetical protein RirG_187470 [Rhizophagus irregularis DAOM 197198w] Length = 134 Score = 99.0 bits (245), Expect = 1e-18 Identities = 45/60 (75%), Positives = 52/60 (86%) Frame = -1 Query: 185 DYGKDLSNTAYRKASQASESSQGLFDQSCHYVQATCSQLSDTTKYYWHQFPPLRWATYTL 6 D GKDLS+ AY KA QASE+S+GLF+Q+ HYVQAT SQLS TTKY WH+FPP+RWATYTL Sbjct: 14 DSGKDLSSAAYDKAYQASETSRGLFNQTSHYVQATASQLSGTTKYCWHEFPPIRWATYTL 73