BLASTX nr result
ID: Anemarrhena21_contig00063212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063212 (240 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007684995.1| hypothetical protein COCMIDRAFT_87217 [Bipol... 160 2e-37 ref|XP_001803376.1| hypothetical protein SNOG_13164 [Phaeosphaer... 159 7e-37 ref|XP_001937048.1| argininosuccinate synthase [Pyrenophora trit... 159 9e-37 ref|XP_008024272.1| hypothetical protein SETTUDRAFT_168631 [Seto... 158 2e-36 ref|XP_003839648.1| similar to argininosuccinate synthase [Lepto... 156 4e-36 ref|XP_001820948.1| argininosuccinate synthase [Aspergillus oryz... 149 7e-34 ref|XP_001396773.1| argininosuccinate synthase [Aspergillus nige... 145 8e-33 gb|KIY03461.1| hypothetical protein Z520_00152 [Fonsecaea multim... 145 1e-32 ref|XP_007786902.1| Argininosuccinate synthase [Endocarpon pusil... 144 2e-32 gb|KIW83784.1| argininosuccinate synthase [Fonsecaea pedrosoi CB... 144 3e-32 gb|KIW23424.1| argininosuccinate synthase [Cladophialophora immu... 144 3e-32 gb|KIW97511.1| argininosuccinate synthase [Cladophialophora bant... 143 4e-32 ref|XP_007748257.1| argininosuccinate synthase [Cladophialophora... 143 4e-32 gb|KJR85102.1| argininosuccinate synthase [Sporothrix schenckii ... 143 5e-32 gb|KIH91160.1| argininosuccinate synthase [Sporothrix brasiliens... 143 5e-32 gb|ERT00417.1| argininosuccinate synthase [Sporothrix schenckii ... 143 5e-32 gb|EFX02371.1| argininosuccinate synthase [Grosmannia clavigera ... 139 6e-31 dbj|GAD94143.1| hypothetical protein SNOG_13164 [Byssochlamys sp... 138 2e-30 ref|XP_007918405.1| putative argininosuccinate synthase protein ... 138 2e-30 gb|EPE02669.1| argininosuccinate synthase [Ophiostoma piceae UAM... 137 3e-30 >ref|XP_007684995.1| hypothetical protein COCMIDRAFT_87217 [Bipolaris oryzae ATCC 44560] gi|628071039|ref|XP_007700173.1| hypothetical protein COCSADRAFT_324343 [Bipolaris sorokiniana ND90Pr] gi|628227289|ref|XP_007715838.1| hypothetical protein COCCADRAFT_105424 [Bipolaris zeicola 26-R-13] gi|451851060|gb|EMD64361.1| hypothetical protein COCSADRAFT_324343 [Bipolaris sorokiniana ND90Pr] gi|451996281|gb|EMD88748.1| hypothetical protein COCHEDRAFT_1196676 [Bipolaris maydis C5] gi|477588458|gb|ENI05537.1| hypothetical protein COCC4DRAFT_168440 [Bipolaris maydis ATCC 48331] gi|576915566|gb|EUC29860.1| hypothetical protein COCCADRAFT_105424 [Bipolaris zeicola 26-R-13] gi|576935069|gb|EUC48577.1| hypothetical protein COCMIDRAFT_87217 [Bipolaris oryzae ATCC 44560] gi|578491006|gb|EUN28417.1| hypothetical protein COCVIDRAFT_95660 [Bipolaris victoriae FI3] Length = 415 Score = 160 bits (406), Expect = 2e-37 Identities = 75/80 (93%), Positives = 80/80 (100%) Frame = -1 Query: 240 LALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRD 61 +ALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLV+DAQVR++RD Sbjct: 249 VALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVMDAQVRNLRD 308 Query: 60 QFVSHHWSYQLYNGMYFSPE 1 QFVSH+WSYQLYNGMYFSPE Sbjct: 309 QFVSHNWSYQLYNGMYFSPE 328 >ref|XP_001803376.1| hypothetical protein SNOG_13164 [Phaeosphaeria nodorum SN15] gi|111058371|gb|EAT79491.1| hypothetical protein SNOG_13164 [Phaeosphaeria nodorum SN15] Length = 415 Score = 159 bits (402), Expect = 7e-37 Identities = 74/80 (92%), Positives = 80/80 (100%) Frame = -1 Query: 240 LALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRD 61 +ALNKLG+THGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLV+DAQVR++RD Sbjct: 249 VALNKLGFTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVMDAQVRNLRD 308 Query: 60 QFVSHHWSYQLYNGMYFSPE 1 QFVSH+WSYQLYNGMYFSPE Sbjct: 309 QFVSHNWSYQLYNGMYFSPE 328 >ref|XP_001937048.1| argininosuccinate synthase [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330922655|ref|XP_003299921.1| hypothetical protein PTT_11028 [Pyrenophora teres f. teres 0-1] gi|187984147|gb|EDU49635.1| argininosuccinate synthase [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311326191|gb|EFQ91983.1| hypothetical protein PTT_11028 [Pyrenophora teres f. teres 0-1] Length = 415 Score = 159 bits (401), Expect = 9e-37 Identities = 74/79 (93%), Positives = 79/79 (100%) Frame = -1 Query: 237 ALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQ 58 ALNKLG+THGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLV+DAQVR++RDQ Sbjct: 250 ALNKLGFTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVMDAQVRNLRDQ 309 Query: 57 FVSHHWSYQLYNGMYFSPE 1 FVSH+WSYQLYNGMYFSPE Sbjct: 310 FVSHNWSYQLYNGMYFSPE 328 >ref|XP_008024272.1| hypothetical protein SETTUDRAFT_168631 [Setosphaeria turcica Et28A] gi|482811477|gb|EOA88233.1| hypothetical protein SETTUDRAFT_168631 [Setosphaeria turcica Et28A] Length = 415 Score = 158 bits (399), Expect = 2e-36 Identities = 73/80 (91%), Positives = 80/80 (100%) Frame = -1 Query: 240 LALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRD 61 +ALNKLG+THGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLV+DAQVR++RD Sbjct: 249 VALNKLGFTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVMDAQVRNLRD 308 Query: 60 QFVSHHWSYQLYNGMYFSPE 1 QFV+H+WSYQLYNGMYFSPE Sbjct: 309 QFVTHNWSYQLYNGMYFSPE 328 >ref|XP_003839648.1| similar to argininosuccinate synthase [Leptosphaeria maculans JN3] gi|312216218|emb|CBX96169.1| similar to argininosuccinate synthase [Leptosphaeria maculans JN3] Length = 415 Score = 156 bits (395), Expect = 4e-36 Identities = 73/79 (92%), Positives = 78/79 (98%) Frame = -1 Query: 237 ALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQ 58 ALNKLG+ HGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLV+DAQVR++RDQ Sbjct: 250 ALNKLGFIHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVMDAQVRNLRDQ 309 Query: 57 FVSHHWSYQLYNGMYFSPE 1 FVSH+WSYQLYNGMYFSPE Sbjct: 310 FVSHNWSYQLYNGMYFSPE 328 >ref|XP_001820948.1| argininosuccinate synthase [Aspergillus oryzae RIB40] gi|238490888|ref|XP_002376681.1| argininosuccinate synthase [Aspergillus flavus NRRL3357] gi|83768809|dbj|BAE58946.1| unnamed protein product [Aspergillus oryzae RIB40] gi|220697094|gb|EED53435.1| argininosuccinate synthase [Aspergillus flavus NRRL3357] gi|391865557|gb|EIT74836.1| argininosuccinate synthase [Aspergillus oryzae 3.042] gi|635509329|gb|KDE81296.1| argininosuccinate [Aspergillus oryzae 100-8] gi|768701852|gb|KJJ28972.1| Arginosuccinate synthase [Aspergillus flavus AF70] Length = 417 Score = 149 bits (376), Expect = 7e-34 Identities = 70/79 (88%), Positives = 74/79 (93%) Frame = -1 Query: 237 ALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQ 58 ALNKLGYTHG+GRIDIVENRFIGLKSRGCYDSPAMTILR AHLDLEGLVLD QVRS+RDQ Sbjct: 252 ALNKLGYTHGVGRIDIVENRFIGLKSRGCYDSPAMTILRAAHLDLEGLVLDGQVRSLRDQ 311 Query: 57 FVSHHWSYQLYNGMYFSPE 1 FV+H+WS LYNG YFSPE Sbjct: 312 FVTHNWSILLYNGYYFSPE 330 >ref|XP_001396773.1| argininosuccinate synthase [Aspergillus niger CBS 513.88] gi|134082293|emb|CAK42337.1| unnamed protein product [Aspergillus niger] gi|350636227|gb|EHA24587.1| hypothetical protein ASPNIDRAFT_40489 [Aspergillus niger ATCC 1015] gi|358373959|dbj|GAA90554.1| argininosuccinate synthase [Aspergillus kawachii IFO 4308] Length = 417 Score = 145 bits (367), Expect = 8e-33 Identities = 67/78 (85%), Positives = 74/78 (94%) Frame = -1 Query: 234 LNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQF 55 LNK+G+THG+GRIDIVENRFIGLKSRGCYDSPAMTILR AHLDLEGLVLD QVR++RDQF Sbjct: 253 LNKIGFTHGVGRIDIVENRFIGLKSRGCYDSPAMTILRDAHLDLEGLVLDGQVRALRDQF 312 Query: 54 VSHHWSYQLYNGMYFSPE 1 V+H+WS QLYNG YFSPE Sbjct: 313 VTHNWSIQLYNGYYFSPE 330 >gb|KIY03461.1| hypothetical protein Z520_00152 [Fonsecaea multimorphosa CBS 102226] Length = 409 Score = 145 bits (365), Expect = 1e-32 Identities = 68/78 (87%), Positives = 73/78 (93%) Frame = -1 Query: 234 LNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQF 55 LN++G HGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLD QVR++RDQF Sbjct: 251 LNRIGKVHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDGQVRALRDQF 310 Query: 54 VSHHWSYQLYNGMYFSPE 1 VSH+WS LYNGMYFSPE Sbjct: 311 VSHNWSNYLYNGMYFSPE 328 >ref|XP_007786902.1| Argininosuccinate synthase [Endocarpon pusillum Z07020] gi|539440266|gb|ERF75744.1| Argininosuccinate synthase [Endocarpon pusillum Z07020] Length = 409 Score = 144 bits (364), Expect = 2e-32 Identities = 68/78 (87%), Positives = 74/78 (94%) Frame = -1 Query: 234 LNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQF 55 LN++G HGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVR++RDQF Sbjct: 251 LNRIGKVHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRALRDQF 310 Query: 54 VSHHWSYQLYNGMYFSPE 1 V+H+WS LYNGMYFSPE Sbjct: 311 VTHNWSTFLYNGMYFSPE 328 >gb|KIW83784.1| argininosuccinate synthase [Fonsecaea pedrosoi CBS 271.37] Length = 409 Score = 144 bits (362), Expect = 3e-32 Identities = 67/78 (85%), Positives = 73/78 (93%) Frame = -1 Query: 234 LNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQF 55 LN++G HGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLD QVR++RDQF Sbjct: 251 LNRIGKVHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDGQVRALRDQF 310 Query: 54 VSHHWSYQLYNGMYFSPE 1 V+H+WS LYNGMYFSPE Sbjct: 311 VTHNWSNYLYNGMYFSPE 328 >gb|KIW23424.1| argininosuccinate synthase [Cladophialophora immunda] Length = 409 Score = 144 bits (362), Expect = 3e-32 Identities = 67/78 (85%), Positives = 73/78 (93%) Frame = -1 Query: 234 LNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQF 55 LN++G HGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLD QVR++RDQF Sbjct: 251 LNRIGKVHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDGQVRALRDQF 310 Query: 54 VSHHWSYQLYNGMYFSPE 1 V+H+WS LYNGMYFSPE Sbjct: 311 VTHNWSNYLYNGMYFSPE 328 >gb|KIW97511.1| argininosuccinate synthase [Cladophialophora bantiana CBS 173.52] Length = 409 Score = 143 bits (361), Expect = 4e-32 Identities = 67/78 (85%), Positives = 73/78 (93%) Frame = -1 Query: 234 LNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQF 55 LN++G HGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLD QVR++RDQF Sbjct: 251 LNRVGKVHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDGQVRALRDQF 310 Query: 54 VSHHWSYQLYNGMYFSPE 1 V+H+WS LYNGMYFSPE Sbjct: 311 VTHNWSNYLYNGMYFSPE 328 >ref|XP_007748257.1| argininosuccinate synthase [Cladophialophora psammophila CBS 110553] gi|589984373|gb|EXJ67475.1| argininosuccinate synthase [Cladophialophora psammophila CBS 110553] Length = 409 Score = 143 bits (361), Expect = 4e-32 Identities = 67/78 (85%), Positives = 73/78 (93%) Frame = -1 Query: 234 LNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQF 55 LN++G HGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLD QVR++RDQF Sbjct: 251 LNRVGKVHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDGQVRALRDQF 310 Query: 54 VSHHWSYQLYNGMYFSPE 1 V+H+WS LYNGMYFSPE Sbjct: 311 VTHNWSNYLYNGMYFSPE 328 >gb|KJR85102.1| argininosuccinate synthase [Sporothrix schenckii 1099-18] Length = 416 Score = 143 bits (360), Expect = 5e-32 Identities = 67/80 (83%), Positives = 72/80 (90%) Frame = -1 Query: 240 LALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRD 61 L N LG THGIGRIDIVENRFIGLKSRGCYD+P MT+LRLAHLDLEGLVLD +VRS+RD Sbjct: 249 LQANALGKTHGIGRIDIVENRFIGLKSRGCYDAPGMTLLRLAHLDLEGLVLDGKVRSLRD 308 Query: 60 QFVSHHWSYQLYNGMYFSPE 1 QFV+HHWS LYNGMYFSPE Sbjct: 309 QFVTHHWSELLYNGMYFSPE 328 >gb|KIH91160.1| argininosuccinate synthase [Sporothrix brasiliensis 5110] Length = 416 Score = 143 bits (360), Expect = 5e-32 Identities = 67/80 (83%), Positives = 72/80 (90%) Frame = -1 Query: 240 LALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRD 61 L N LG THGIGRIDIVENRFIGLKSRGCYD+P MT+LRLAHLDLEGLVLD +VRS+RD Sbjct: 249 LQANALGKTHGIGRIDIVENRFIGLKSRGCYDAPGMTLLRLAHLDLEGLVLDGKVRSLRD 308 Query: 60 QFVSHHWSYQLYNGMYFSPE 1 QFV+HHWS LYNGMYFSPE Sbjct: 309 QFVTHHWSELLYNGMYFSPE 328 >gb|ERT00417.1| argininosuccinate synthase [Sporothrix schenckii ATCC 58251] Length = 416 Score = 143 bits (360), Expect = 5e-32 Identities = 67/80 (83%), Positives = 72/80 (90%) Frame = -1 Query: 240 LALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRD 61 L N LG THGIGRIDIVENRFIGLKSRGCYD+P MT+LRLAHLDLEGLVLD +VRS+RD Sbjct: 249 LQANALGKTHGIGRIDIVENRFIGLKSRGCYDAPGMTLLRLAHLDLEGLVLDGKVRSLRD 308 Query: 60 QFVSHHWSYQLYNGMYFSPE 1 QFV+HHWS LYNGMYFSPE Sbjct: 309 QFVTHHWSELLYNGMYFSPE 328 >gb|EFX02371.1| argininosuccinate synthase [Grosmannia clavigera kw1407] Length = 414 Score = 139 bits (351), Expect = 6e-31 Identities = 65/77 (84%), Positives = 71/77 (92%) Frame = -1 Query: 231 NKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQFV 52 N++G HGIGRIDIVENRFIGLKSRGCYDSP MTILRLAHLDLEGLV+D +VRS+RDQFV Sbjct: 252 NEIGKEHGIGRIDIVENRFIGLKSRGCYDSPGMTILRLAHLDLEGLVMDGKVRSLRDQFV 311 Query: 51 SHHWSYQLYNGMYFSPE 1 SH+WS LYNGMYFSPE Sbjct: 312 SHNWSELLYNGMYFSPE 328 >dbj|GAD94143.1| hypothetical protein SNOG_13164 [Byssochlamys spectabilis No. 5] Length = 414 Score = 138 bits (347), Expect = 2e-30 Identities = 64/80 (80%), Positives = 73/80 (91%) Frame = -1 Query: 240 LALNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRD 61 +ALN++G +GIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLD E LV+D +VRS+RD Sbjct: 248 VALNEIGCKNGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDAESLVMDGRVRSLRD 307 Query: 60 QFVSHHWSYQLYNGMYFSPE 1 QFV+HHWS LYNG+YFSPE Sbjct: 308 QFVTHHWSELLYNGLYFSPE 327 >ref|XP_007918405.1| putative argininosuccinate synthase protein [Togninia minima UCRPA7] gi|500253215|gb|EON96952.1| putative argininosuccinate synthase protein [Togninia minima UCRPA7] Length = 444 Score = 138 bits (347), Expect = 2e-30 Identities = 64/78 (82%), Positives = 71/78 (91%) Frame = -1 Query: 234 LNKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQF 55 LN++G HGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAH+DLEGLV+D +RS+RDQF Sbjct: 283 LNEIGKIHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHMDLEGLVMDQSMRSMRDQF 342 Query: 54 VSHHWSYQLYNGMYFSPE 1 VSH W+ LYNGMYFSPE Sbjct: 343 VSHEWAKLLYNGMYFSPE 360 >gb|EPE02669.1| argininosuccinate synthase [Ophiostoma piceae UAMH 11346] Length = 412 Score = 137 bits (345), Expect = 3e-30 Identities = 63/77 (81%), Positives = 71/77 (92%) Frame = -1 Query: 231 NKLGYTHGIGRIDIVENRFIGLKSRGCYDSPAMTILRLAHLDLEGLVLDAQVRSIRDQFV 52 N++G HGIGRIDIVENRFIGLKSRGCYD+P MTILRLAHLDLEGLV+D +VRS+RDQFV Sbjct: 252 NEIGKIHGIGRIDIVENRFIGLKSRGCYDAPGMTILRLAHLDLEGLVMDGKVRSLRDQFV 311 Query: 51 SHHWSYQLYNGMYFSPE 1 +H+WS LYNGMYFSPE Sbjct: 312 THNWSELLYNGMYFSPE 328