BLASTX nr result
ID: Anemarrhena21_contig00063169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063169 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW41282.1| glutamine synthetase [Exophiala oligosperma] 91 3e-16 gb|KIW14682.1| glutamine synthetase [Exophiala spinifera] 91 3e-16 gb|KIX97251.1| glutamine synthetase [Fonsecaea multimorphosa CBS... 91 4e-16 gb|KIW26069.1| glutamine synthetase [Cladophialophora immunda] 91 4e-16 ref|XP_007729884.1| glutamine synthetase [Capronia epimyces CBS ... 90 7e-16 gb|KIW63268.1| glutamine synthetase [Capronia semiimmersa] 89 9e-16 ref|XP_007723060.1| glutamine synthetase [Capronia coronata CBS ... 89 9e-16 gb|KEF63852.1| glutamine synthetase [Exophiala aquamarina CBS 11... 89 1e-15 gb|KIW94837.1| glutamine synthetase [Cladophialophora bantiana C... 89 2e-15 gb|KIW77383.1| glutamine synthetase [Fonsecaea pedrosoi CBS 271.37] 89 2e-15 gb|KIV92210.1| glutamine synthetase [Exophiala mesophila] 89 2e-15 ref|XP_007744706.1| glutamine synthetase [Cladophialophora psamm... 89 2e-15 gb|KIX03999.1| glutamine synthetase [Rhinocladiella mackenziei C... 88 2e-15 gb|KIW59439.1| glutamine synthetase [Exophiala xenobiotica] 88 2e-15 ref|XP_007801410.1| Glutamine synthetase [Endocarpon pusillum Z0... 88 2e-15 ref|XP_009160424.1| glutamine synthetase [Exophiala dermatitidis... 88 2e-15 ref|XP_007761650.1| glutamine synthetase [Cladophialophora yegre... 88 3e-15 gb|KKY21587.1| putative glutamine synthetase [Phaeomoniella chla... 87 6e-15 ref|XP_008731955.1| glutamine synthetase [Cladophialophora carri... 87 6e-15 gb|KIV83568.1| glutamine synthetase [Exophiala sideris] 86 1e-14 >gb|KIW41282.1| glutamine synthetase [Exophiala oligosperma] Length = 365 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CAK+GKGYFEDRRPASNADPYQITGIIVET+YGSLP EK Sbjct: 319 SVRIPRACAKEGKGYFEDRRPASNADPYQITGIIVETMYGSLPEEK 364 >gb|KIW14682.1| glutamine synthetase [Exophiala spinifera] Length = 346 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/46 (91%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CAK+GKGYFEDRRPASNADPYQITGIIVET+YGSLP EK Sbjct: 300 SVRIPRACAKEGKGYFEDRRPASNADPYQITGIIVETMYGSLPEEK 345 >gb|KIX97251.1| glutamine synthetase [Fonsecaea multimorphosa CBS 102226] Length = 367 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQ+TG+IVET+YGSLPAEK Sbjct: 322 SVRIPRACAREGKGYFEDRRPASNADPYQVTGMIVETLYGSLPAEK 367 >gb|KIW26069.1| glutamine synthetase [Cladophialophora immunda] Length = 364 Score = 90.5 bits (223), Expect = 4e-16 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQ+TG+IVET+YGSLPAEK Sbjct: 319 SVRIPRACAREGKGYFEDRRPASNADPYQVTGMIVETLYGSLPAEK 364 >ref|XP_007729884.1| glutamine synthetase [Capronia epimyces CBS 606.96] gi|590017794|gb|EXJ92994.1| glutamine synthetase [Capronia epimyces CBS 606.96] Length = 345 Score = 89.7 bits (221), Expect = 7e-16 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQITGIIVET+YGSLP EK Sbjct: 300 SVRIPRACAREGKGYFEDRRPASNADPYQITGIIVETMYGSLPEEK 345 >gb|KIW63268.1| glutamine synthetase [Capronia semiimmersa] Length = 366 Score = 89.4 bits (220), Expect = 9e-16 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CAK+GKGYFEDRRPASNADPYQ+TG++VET+YGSLP EK Sbjct: 319 SVRIPRACAKEGKGYFEDRRPASNADPYQVTGMVVETLYGSLPEEK 364 >ref|XP_007723060.1| glutamine synthetase [Capronia coronata CBS 617.96] gi|590015665|gb|EXJ90866.1| glutamine synthetase [Capronia coronata CBS 617.96] Length = 345 Score = 89.4 bits (220), Expect = 9e-16 Identities = 41/46 (89%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CAK+GKGYFEDRRPASNADPY+ITGIIVET+YGSLP EK Sbjct: 300 SVRIPRACAKEGKGYFEDRRPASNADPYRITGIIVETMYGSLPEEK 345 >gb|KEF63852.1| glutamine synthetase [Exophiala aquamarina CBS 119918] Length = 281 Score = 89.0 bits (219), Expect = 1e-15 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQITGI+VET+YGSLP EK Sbjct: 235 SVRIPRACAREGKGYFEDRRPASNADPYQITGILVETMYGSLPEEK 280 >gb|KIW94837.1| glutamine synthetase [Cladophialophora bantiana CBS 173.52] Length = 366 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQ+TG+IVET+YGSLP EK Sbjct: 319 SVRIPRACAREGKGYFEDRRPASNADPYQVTGMIVETLYGSLPEEK 364 >gb|KIW77383.1| glutamine synthetase [Fonsecaea pedrosoi CBS 271.37] Length = 346 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQ+TG+IVET+YGSLP EK Sbjct: 300 SVRIPRACAREGKGYFEDRRPASNADPYQVTGMIVETLYGSLPEEK 345 >gb|KIV92210.1| glutamine synthetase [Exophiala mesophila] Length = 365 Score = 88.6 bits (218), Expect = 2e-15 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQITGIIVET+YG+LP EK Sbjct: 319 SVRIPRACAREGKGYFEDRRPASNADPYQITGIIVETMYGALPEEK 364 >ref|XP_007744706.1| glutamine synthetase [Cladophialophora psammophila CBS 110553] gi|589988069|gb|EXJ70927.1| glutamine synthetase [Cladophialophora psammophila CBS 110553] Length = 366 Score = 88.6 bits (218), Expect = 2e-15 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQ+TG+IVET+YGSLP EK Sbjct: 319 SVRIPRACAREGKGYFEDRRPASNADPYQVTGMIVETLYGSLPEEK 364 >gb|KIX03999.1| glutamine synthetase [Rhinocladiella mackenziei CBS 650.93] Length = 365 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASN DPYQITGIIVET+YGSLP EK Sbjct: 319 SVRIPRACAREGKGYFEDRRPASNGDPYQITGIIVETMYGSLPEEK 364 >gb|KIW59439.1| glutamine synthetase [Exophiala xenobiotica] Length = 367 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASN DPYQITGII+ETIYGSLP EK Sbjct: 320 SVRIPRACAREGKGYFEDRRPASNGDPYQITGIIMETIYGSLPEEK 365 >ref|XP_007801410.1| Glutamine synthetase [Endocarpon pusillum Z07020] gi|539436928|gb|ERF72974.1| Glutamine synthetase [Endocarpon pusillum Z07020] Length = 337 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/46 (86%), Positives = 43/46 (93%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQITGIIVETIYG LP E+ Sbjct: 292 SVRIPRSCAREGKGYFEDRRPASNADPYQITGIIVETIYGGLPPEQ 337 >ref|XP_009160424.1| glutamine synthetase [Exophiala dermatitidis NIH/UT8656] gi|378733504|gb|EHY59963.1| glutamine synthetase [Exophiala dermatitidis NIH/UT8656] Length = 364 Score = 88.2 bits (217), Expect = 2e-15 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVRIPR CA++GKGYFEDRRPASNADPYQITGIIVET++GSLP EK Sbjct: 319 SVRIPRACAREGKGYFEDRRPASNADPYQITGIIVETMFGSLPEEK 364 >ref|XP_007761650.1| glutamine synthetase [Cladophialophora yegresii CBS 114405] gi|589970777|gb|EXJ54135.1| glutamine synthetase [Cladophialophora yegresii CBS 114405] Length = 367 Score = 87.8 bits (216), Expect = 3e-15 Identities = 38/46 (82%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVR+PR CAK+GKGYFEDRRPASNADPYQ+TG+IVET++GSLP EK Sbjct: 320 SVRVPRACAKEGKGYFEDRRPASNADPYQVTGMIVETLFGSLPEEK 365 >gb|KKY21587.1| putative glutamine synthetase [Phaeomoniella chlamydospora] Length = 367 Score = 86.7 bits (213), Expect = 6e-15 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAE 134 SVRIPRQ A+DGKGYFEDRRPASNADPYQITGIIVET+YG+LP E Sbjct: 316 SVRIPRQVARDGKGYFEDRRPASNADPYQITGIIVETMYGALPPE 360 >ref|XP_008731955.1| glutamine synthetase [Cladophialophora carrionii CBS 160.54] gi|565930265|gb|ETI19596.1| glutamine synthetase [Cladophialophora carrionii CBS 160.54] Length = 382 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAEK 131 SVR+PR CA++GKGYFEDRRPASNADPYQ+TG+IVET++GSLP EK Sbjct: 335 SVRVPRACAREGKGYFEDRRPASNADPYQVTGMIVETLFGSLPEEK 380 >gb|KIV83568.1| glutamine synthetase [Exophiala sideris] Length = 367 Score = 85.9 bits (211), Expect = 1e-14 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -2 Query: 268 SVRIPRQCAKDGKGYFEDRRPASNADPYQITGIIVETIYGSLPAE 134 SVRIPR CAK+GKGYFEDRRPASN DPYQITGI++ET+YGSLP E Sbjct: 319 SVRIPRACAKEGKGYFEDRRPASNGDPYQITGIMIETMYGSLPEE 363