BLASTX nr result
ID: Anemarrhena21_contig00063168
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00063168 (375 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001794197.1| hypothetical protein SNOG_03643 [Phaeosphaer... 102 1e-19 gb|KIH90863.1| ornithine decarboxylase [Sporothrix brasiliensis ... 100 5e-19 gb|ERS95761.1| ornithine decarboxylase [Sporothrix schenckii ATC... 100 5e-19 ref|XP_007917697.1| putative ornithine decarboxylase protein [To... 99 1e-18 gb|ENH82535.1| ornithine decarboxylase [Colletotrichum orbicular... 99 1e-18 ref|XP_009648453.1| ornithine decarboxylase [Verticillium dahlia... 99 1e-18 ref|XP_009848008.1| Ornithine decarboxylase [Neurospora tetraspe... 99 1e-18 ref|XP_960749.1| ornithine decarboxylase [Neurospora crassa OR74... 99 1e-18 ref|XP_003661406.1| hypothetical protein MYCTH_2300746 [Myceliop... 98 2e-18 ref|XP_001229110.1| hypothetical protein CHGG_02594 [Chaetomium ... 98 2e-18 ref|XP_007798109.1| putative ornithine decarboxylase protein [Eu... 98 2e-18 gb|EWG42804.1| ornithine decarboxylase [Fusarium verticillioides... 97 3e-18 gb|KLO96490.1| putative ornithine decarboxylase [Fusarium fujiku... 97 3e-18 gb|EXM34153.1| ornithine decarboxylase [Fusarium oxysporum f. sp... 97 3e-18 emb|CCT66920.1| probable ornithine decarboxylase [Fusarium fujik... 97 3e-18 gb|EPE02921.1| ornithine decarboxylase [Ophiostoma piceae UAMH 1... 97 3e-18 gb|EMT68095.1| Ornithine decarboxylase [Fusarium oxysporum f. sp... 97 3e-18 gb|EGU84976.1| hypothetical protein FOXB_04557 [Fusarium oxyspor... 97 3e-18 gb|KIL91307.1| hypothetical protein FAVG1_04921 [Fusarium avenac... 97 4e-18 ref|XP_011324512.1| ornithine decarboxylase [Fusarium graminearu... 97 4e-18 >ref|XP_001794197.1| hypothetical protein SNOG_03643 [Phaeosphaeria nodorum SN15] gi|5921568|emb|CAB56523.1| ornithine decarboxylase [Parastagonospora nodorum] gi|160705959|gb|EAT88848.2| hypothetical protein SNOG_03643 [Phaeosphaeria nodorum SN15] Length = 445 Score = 102 bits (254), Expect = 1e-19 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F +++DVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGA AL+G+ Sbjct: 395 FPELLDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGAKALMGM 445 >gb|KIH90863.1| ornithine decarboxylase [Sporothrix brasiliensis 5110] Length = 460 Score = 100 bits (248), Expect = 5e-19 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 FR +DVGDWLYFEDMGAYT CSAT+FNGFTD+HDV+YVCSEPGA ALLG+ Sbjct: 409 FRQTLDVGDWLYFEDMGAYTSCSATRFNGFTDNHDVIYVCSEPGARALLGM 459 >gb|ERS95761.1| ornithine decarboxylase [Sporothrix schenckii ATCC 58251] gi|780593040|gb|KJR83778.1| ornithine decarboxylase [Sporothrix schenckii 1099-18] Length = 460 Score = 100 bits (248), Expect = 5e-19 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 FR +DVGDWLYFEDMGAYT CSAT+FNGFTD+HDV+YVCSEPGA ALLG+ Sbjct: 409 FRQTLDVGDWLYFEDMGAYTSCSATRFNGFTDNHDVIYVCSEPGARALLGM 459 >ref|XP_007917697.1| putative ornithine decarboxylase protein [Togninia minima UCRPA7] gi|500253900|gb|EON97547.1| putative ornithine decarboxylase protein [Togninia minima UCRPA7] Length = 468 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F +DVGDWLYFEDMGAYTKCSATKFNGF+DSHDV+YVCSEPGA AL+G+ Sbjct: 415 FEQTLDVGDWLYFEDMGAYTKCSATKFNGFSDSHDVIYVCSEPGALALMGM 465 >gb|ENH82535.1| ornithine decarboxylase [Colletotrichum orbiculare MAFF 240422] Length = 451 Score = 99.0 bits (245), Expect = 1e-18 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F +DVGDWLYFEDMGAYTKCSATKFNGF+D HDV+YVCSEPGA ALLGL Sbjct: 401 FEHELDVGDWLYFEDMGAYTKCSATKFNGFSDDHDVIYVCSEPGAKALLGL 451 >ref|XP_009648453.1| ornithine decarboxylase [Verticillium dahliae VdLs.17] gi|346974138|gb|EGY17590.1| ornithine decarboxylase [Verticillium dahliae VdLs.17] Length = 453 Score = 99.0 bits (245), Expect = 1e-18 Identities = 43/51 (84%), Positives = 46/51 (90%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F +DVGDWLYFEDMGAYTKCSATKFNGF+D HDV+YVCSEPGA ALLGL Sbjct: 403 FEHELDVGDWLYFEDMGAYTKCSATKFNGFSDDHDVIYVCSEPGARALLGL 453 >ref|XP_009848008.1| Ornithine decarboxylase [Neurospora tetrasperma FGSC 2508] gi|336472649|gb|EGO60809.1| Ornithine decarboxylase [Neurospora tetrasperma FGSC 2508] gi|350294118|gb|EGZ75203.1| ornithine decarboxylase [Neurospora tetrasperma FGSC 2509] Length = 484 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 FR+++DVGDWLYFEDMGAYTKCSAT FNGF++ HDV+YVCSEPGA ALLGL Sbjct: 434 FREILDVGDWLYFEDMGAYTKCSATTFNGFSNEHDVIYVCSEPGAMALLGL 484 >ref|XP_960749.1| ornithine decarboxylase [Neurospora crassa OR74A] gi|118381|sp|P27121.1|DCOR_NEUCR RecName: Full=Ornithine decarboxylase; Short=ODC gi|168854|gb|AAA33604.1| ornithine decarboxylase [Neurospora crassa] gi|168856|gb|AAA33605.1| ornithine decarboxylase [Neurospora crassa] gi|293958|gb|AAA33614.1| ornithine decarboxylase [Neurospora crassa] gi|28922270|gb|EAA31513.1| ornithine decarboxylase [Neurospora crassa OR74A] gi|38566814|emb|CAE76122.1| ornithine decarboxylase [Neurospora crassa] gi|725979289|gb|KHE82540.1| hypothetical protein GE21DRAFT_7689 [Neurospora crassa] Length = 484 Score = 99.0 bits (245), Expect = 1e-18 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 FR+++DVGDWLYFEDMGAYTKCSAT FNGF++ HDV+YVCSEPGA ALLGL Sbjct: 434 FREILDVGDWLYFEDMGAYTKCSATTFNGFSNEHDVIYVCSEPGAMALLGL 484 >ref|XP_003661406.1| hypothetical protein MYCTH_2300746 [Myceliophthora thermophila ATCC 42464] gi|347008674|gb|AEO56161.1| hypothetical protein MYCTH_2300746 [Myceliophthora thermophila ATCC 42464] Length = 462 Score = 98.2 bits (243), Expect = 2e-18 Identities = 42/51 (82%), Positives = 47/51 (92%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT FNGFT+SHDV+YVCSEPGA ALLG+ Sbjct: 411 FAQLLDVGDWLYFEDMGAYTKCSATTFNGFTNSHDVIYVCSEPGAKALLGM 461 >ref|XP_001229110.1| hypothetical protein CHGG_02594 [Chaetomium globosum CBS 148.51] gi|88183191|gb|EAQ90659.1| hypothetical protein CHGG_02594 [Chaetomium globosum CBS 148.51] Length = 459 Score = 97.8 bits (242), Expect = 2e-18 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT FNGFT+SHDV+YVCSEPGA ALLGL Sbjct: 408 FPRLLDVGDWLYFEDMGAYTKCSATTFNGFTNSHDVIYVCSEPGAKALLGL 458 >ref|XP_007798109.1| putative ornithine decarboxylase protein [Eutypa lata UCREL1] gi|471560773|gb|EMR62790.1| putative ornithine decarboxylase protein [Eutypa lata UCREL1] Length = 447 Score = 97.8 bits (242), Expect = 2e-18 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLG 222 F +DVGDWLYFEDMGAYTKCSATKFNGF+D+HDV+YVCSEPGA ALLG Sbjct: 397 FNHELDVGDWLYFEDMGAYTKCSATKFNGFSDAHDVIYVCSEPGARALLG 446 >gb|EWG42804.1| ornithine decarboxylase [Fusarium verticillioides 7600] Length = 448 Score = 97.4 bits (241), Expect = 3e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT+FNGF+++HDV+YVCSEPGA ALLGL Sbjct: 398 FDSILDVGDWLYFEDMGAYTKCSATQFNGFSNAHDVIYVCSEPGAKALLGL 448 >gb|KLO96490.1| putative ornithine decarboxylase [Fusarium fujikuroi] gi|829120545|gb|KLO96644.1| putative ornithine decarboxylase [Fusarium fujikuroi] gi|829152496|gb|KLP20216.1| putative ornithine decarboxylase [Fusarium fujikuroi] Length = 448 Score = 97.4 bits (241), Expect = 3e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT+FNGF+++HDV+YVCSEPGA ALLGL Sbjct: 398 FDSILDVGDWLYFEDMGAYTKCSATQFNGFSNAHDVIYVCSEPGARALLGL 448 >gb|EXM34153.1| ornithine decarboxylase [Fusarium oxysporum f. sp. vasinfectum 25433] Length = 448 Score = 97.4 bits (241), Expect = 3e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT+FNGF+++HDV+YVCSEPGA ALLGL Sbjct: 398 FDSILDVGDWLYFEDMGAYTKCSATQFNGFSNAHDVIYVCSEPGAKALLGL 448 >emb|CCT66920.1| probable ornithine decarboxylase [Fusarium fujikuroi IMI 58289] Length = 446 Score = 97.4 bits (241), Expect = 3e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT+FNGF+++HDV+YVCSEPGA ALLGL Sbjct: 396 FDSILDVGDWLYFEDMGAYTKCSATQFNGFSNAHDVIYVCSEPGARALLGL 446 >gb|EPE02921.1| ornithine decarboxylase [Ophiostoma piceae UAMH 11346] Length = 504 Score = 97.4 bits (241), Expect = 3e-18 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F +DVGDWLYFEDMGAYT CSAT+FNGFTD+HDV+YVCSEPGA A+LG+ Sbjct: 409 FHQTLDVGDWLYFEDMGAYTSCSATRFNGFTDNHDVIYVCSEPGARAMLGI 459 >gb|EMT68095.1| Ornithine decarboxylase [Fusarium oxysporum f. sp. cubense race 4] gi|591476050|gb|EXM07222.1| ornithine decarboxylase [Fusarium oxysporum f. sp. cubense tropical race 4 54006] Length = 448 Score = 97.4 bits (241), Expect = 3e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT+FNGF+++HDV+YVCSEPGA ALLGL Sbjct: 398 FDSILDVGDWLYFEDMGAYTKCSATQFNGFSNAHDVIYVCSEPGAKALLGL 448 >gb|EGU84976.1| hypothetical protein FOXB_04557 [Fusarium oxysporum Fo5176] gi|477516533|gb|ENH68814.1| Ornithine decarboxylase [Fusarium oxysporum f. sp. cubense race 1] gi|587680240|gb|EWZ02558.1| ornithine decarboxylase [Fusarium oxysporum FOSC 3-a] gi|587702036|gb|EWZ48641.1| ornithine decarboxylase [Fusarium oxysporum Fo47] gi|587722372|gb|EWZ93709.1| ornithine decarboxylase [Fusarium oxysporum f. sp. lycopersici MN25] gi|587744080|gb|EXA41796.1| ornithine decarboxylase [Fusarium oxysporum f. sp. pisi HDV247] gi|590044136|gb|EXK45994.1| ornithine decarboxylase [Fusarium oxysporum f. sp. melonis 26406] gi|590069253|gb|EXK96777.1| ornithine decarboxylase [Fusarium oxysporum f. sp. raphani 54005] gi|591418837|gb|EXL53974.1| ornithine decarboxylase [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591450258|gb|EXL82610.1| ornithine decarboxylase [Fusarium oxysporum f. sp. conglutinans race 2 54008] Length = 448 Score = 97.4 bits (241), Expect = 3e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT+FNGF+++HDV+YVCSEPGA ALLGL Sbjct: 398 FDSILDVGDWLYFEDMGAYTKCSATQFNGFSNAHDVIYVCSEPGAKALLGL 448 >gb|KIL91307.1| hypothetical protein FAVG1_04921 [Fusarium avenaceum] Length = 448 Score = 97.1 bits (240), Expect = 4e-18 Identities = 40/51 (78%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT+FNGF+++HDV+Y+CSEPGA ALLGL Sbjct: 398 FDSILDVGDWLYFEDMGAYTKCSATQFNGFSNAHDVIYICSEPGAKALLGL 448 >ref|XP_011324512.1| ornithine decarboxylase [Fusarium graminearum PH-1] gi|558861853|gb|ESU11936.1| ornithine decarboxylase [Fusarium graminearum PH-1] gi|596553797|gb|EYB32947.1| hypothetical protein FG05_05903 [Fusarium graminearum] gi|699035562|emb|CEF88547.1| unnamed protein product [Fusarium graminearum] Length = 448 Score = 97.1 bits (240), Expect = 4e-18 Identities = 41/51 (80%), Positives = 48/51 (94%) Frame = -2 Query: 371 FRDVIDVGDWLYFEDMGAYTKCSATKFNGFTDSHDVVYVCSEPGANALLGL 219 F ++DVGDWLYFEDMGAYTKCSAT+FNGF+++HDV+YVCSEPGA ALLGL Sbjct: 398 FDPILDVGDWLYFEDMGAYTKCSATQFNGFSNAHDVIYVCSEPGAKALLGL 448