BLASTX nr result
ID: Anemarrhena21_contig00062919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062919 (289 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010932532.1| PREDICTED: potassium transporter 25-like [El... 67 6e-09 ref|XP_012840008.1| PREDICTED: potassium transporter 2 isoform X... 57 6e-06 >ref|XP_010932532.1| PREDICTED: potassium transporter 25-like [Elaeis guineensis] Length = 778 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/40 (75%), Positives = 38/40 (95%), Gaps = 1/40 (2%) Frame = +1 Query: 169 LSRG-QSKADTWKHTLLLAFQSLGVVFGHLSIGPLYVFHT 285 LS+G +++ DTWKHTLLL+FQSLGV++GHLSIGPLYVF+T Sbjct: 8 LSKGPKARMDTWKHTLLLSFQSLGVIYGHLSIGPLYVFNT 47 >ref|XP_012840008.1| PREDICTED: potassium transporter 2 isoform X1 [Erythranthe guttatus] gi|604330102|gb|EYU35222.1| hypothetical protein MIMGU_mgv1a001492mg [Erythranthe guttata] Length = 809 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/49 (53%), Positives = 34/49 (69%) Frame = +1 Query: 133 EFAQSMDFAAASLSRGQSKADTWKHTLLLAFQSLGVVFGHLSIGPLYVF 279 E A +MD + R + D+WK T+LLA+QSLGVV+G LSI PLYV+ Sbjct: 9 ESAPTMDLGCGNCWRDSKRKDSWKTTMLLAYQSLGVVYGDLSISPLYVY 57