BLASTX nr result
ID: Anemarrhena21_contig00062798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062798 (456 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIO19939.1| hypothetical protein M407DRAFT_142581 [Tulasnella... 57 6e-06 >gb|KIO19939.1| hypothetical protein M407DRAFT_142581 [Tulasnella calospora MUT 4182] Length = 235 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/59 (42%), Positives = 37/59 (62%) Frame = -1 Query: 453 VSVVKSRVHNKTSGAAYADYGSVPWLALVAMLCLWVGTTFSCYNMITHRSARNKNTERY 277 VS+VKS++ + T G A A+YG+ WL LVA L LW+ + +C ++ R AR E+Y Sbjct: 177 VSIVKSKLKDHTDGGATANYGAAVWLVLVAALLLWIASVGACCGVLRTRRARRAEAEKY 235