BLASTX nr result
ID: Anemarrhena21_contig00062795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062795 (405 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001803023.1| hypothetical protein SNOG_12805 [Phaeosphaer... 80 7e-13 ref|XP_008028978.1| carbohydrate-binding module family 21 protei... 78 3e-12 ref|XP_003840756.1| hypothetical protein LEMA_P104080.1 [Leptosp... 77 4e-12 ref|XP_007693151.1| carbohydrate-binding module family 21 protei... 77 6e-12 ref|XP_007715880.1| carbohydrate-binding module family 21 protei... 77 6e-12 gb|EMD93020.1| carbohydrate-binding module family 21 protein [Bi... 77 6e-12 ref|XP_007700830.1| carbohydrate-binding module family 21 protei... 77 6e-12 ref|XP_007779706.1| hypothetical protein W97_03620 [Coniosporium... 71 3e-10 dbj|BAK05214.1| predicted protein [Hordeum vulgare subsp. vulgare] 70 4e-10 ref|XP_001941161.1| protein phosphatase regulator [Pyrenophora t... 70 5e-10 gb|EKG11110.1| Putative phosphatase regulatory subunit [Macropho... 63 9e-08 ref|XP_008079610.1| hypothetical protein GLAREA_06005 [Glarea lo... 60 4e-07 gb|KEF52519.1| hypothetical protein A1O9_11361 [Exophiala aquama... 58 3e-06 ref|XP_008718385.1| hypothetical protein HMPREF1541_05826 [Cyphe... 58 3e-06 dbj|GAM90701.1| hypothetical protein ANO11243_087460 [fungal sp.... 57 5e-06 >ref|XP_001803023.1| hypothetical protein SNOG_12805 [Phaeosphaeria nodorum SN15] gi|160703774|gb|EAT79605.2| hypothetical protein SNOG_12805 [Phaeosphaeria nodorum SN15] Length = 733 Score = 79.7 bits (195), Expect = 7e-13 Identities = 35/49 (71%), Positives = 43/49 (87%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVSS 1 MPYTPP+QRSPA+SK NSP+L+RNHSY +Q P+ PV +RP+LPRSVSS Sbjct: 1 MPYTPPSQRSPASSKTNSPVLTRNHSYIDQSPLSPVSSRRPSLPRSVSS 49 >ref|XP_008028978.1| carbohydrate-binding module family 21 protein [Setosphaeria turcica Et28A] gi|482806114|gb|EOA83187.1| carbohydrate-binding module family 21 protein [Setosphaeria turcica Et28A] Length = 710 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/49 (75%), Positives = 41/49 (83%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVSS 1 MPYTPP+QRSPATSK +SPILSRNHSY + P PV QRP+LPRSVSS Sbjct: 1 MPYTPPSQRSPATSKTSSPILSRNHSYIDHPPHSPVTAQRPSLPRSVSS 49 >ref|XP_003840756.1| hypothetical protein LEMA_P104080.1 [Leptosphaeria maculans JN3] gi|312217329|emb|CBX97277.1| hypothetical protein LEMA_P104080.1 [Leptosphaeria maculans JN3] Length = 768 Score = 77.0 bits (188), Expect = 4e-12 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVSS 1 MPYTPP+QRSPATSK NSPILSRNHSY +Q P QRPALPRSVSS Sbjct: 1 MPYTPPSQRSPATSKTNSPILSRNHSYIDQAPRPSPAVQRPALPRSVSS 49 >ref|XP_007693151.1| carbohydrate-binding module family 21 protein [Bipolaris oryzae ATCC 44560] gi|576926596|gb|EUC40338.1| carbohydrate-binding module family 21 protein [Bipolaris oryzae ATCC 44560] Length = 701 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVSS 1 MPYTPP+QRSPATSK +SP LSRNHSY +Q P PV +RP+LPRSVSS Sbjct: 1 MPYTPPSQRSPATSKTSSPTLSRNHSYVDQPPHSPVTARRPSLPRSVSS 49 >ref|XP_007715880.1| carbohydrate-binding module family 21 protein [Bipolaris zeicola 26-R-13] gi|576915516|gb|EUC29812.1| carbohydrate-binding module family 21 protein [Bipolaris zeicola 26-R-13] gi|578485346|gb|EUN22845.1| carbohydrate-binding module family 21 protein [Bipolaris victoriae FI3] Length = 701 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVSS 1 MPYTPP+QRSPATSK +SP LSRNHSY +Q P PV +RP+LPRSVSS Sbjct: 1 MPYTPPSQRSPATSKTSSPTLSRNHSYVDQPPHSPVTARRPSLPRSVSS 49 >gb|EMD93020.1| carbohydrate-binding module family 21 protein [Bipolaris maydis C5] gi|477587512|gb|ENI04593.1| carbohydrate-binding module family 21 protein [Bipolaris maydis ATCC 48331] Length = 678 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVSS 1 MPYTPP+QRSPATSK +SP LSRNHSY +Q P PV +RP+LPRSVSS Sbjct: 1 MPYTPPSQRSPATSKTSSPTLSRNHSYVDQPPHSPVTTRRPSLPRSVSS 49 >ref|XP_007700830.1| carbohydrate-binding module family 21 protein [Bipolaris sorokiniana ND90Pr] gi|451850524|gb|EMD63826.1| carbohydrate-binding module family 21 protein [Bipolaris sorokiniana ND90Pr] Length = 701 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVSS 1 MPYTPP+QRSPATSK +SP LSRNHSY +Q P PV +RP+LPRSVSS Sbjct: 1 MPYTPPSQRSPATSKTSSPTLSRNHSYVDQPPHSPVTARRPSLPRSVSS 49 >ref|XP_007779706.1| hypothetical protein W97_03620 [Coniosporium apollinis CBS 100218] gi|494827439|gb|EON64389.1| hypothetical protein W97_03620 [Coniosporium apollinis CBS 100218] Length = 628 Score = 70.9 bits (172), Expect = 3e-10 Identities = 35/50 (70%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFP-VGPVHPQRPALPRSVSS 1 MPYTPP QRSPATS PNSP LSR HSY + P + P QRP LPRSVSS Sbjct: 1 MPYTPPAQRSPATSSPNSPTLSRTHSYASEKPGLSPSLAQRPVLPRSVSS 50 >dbj|BAK05214.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 720 Score = 70.5 bits (171), Expect = 4e-10 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVSS 1 MPYTPP+QRSPA S +SP LSRNHSY +Q P P +RP+LPRSVSS Sbjct: 1 MPYTPPSQRSPAPSMTSSPTLSRNHSYVDQPPHSPATSRRPSLPRSVSS 49 >ref|XP_001941161.1| protein phosphatase regulator [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187977254|gb|EDU43880.1| protein phosphatase regulator [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 719 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/49 (67%), Positives = 38/49 (77%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVSS 1 MPYTPP+QRSPA S +SP LSRNHSY +Q P P +RP+LPRSVSS Sbjct: 1 MPYTPPSQRSPAPSMTSSPTLSRNHSYIDQPPRSPATSRRPSLPRSVSS 49 >gb|EKG11110.1| Putative phosphatase regulatory subunit [Macrophomina phaseolina MS6] Length = 725 Score = 62.8 bits (151), Expect = 9e-08 Identities = 34/55 (61%), Positives = 39/55 (70%), Gaps = 6/55 (10%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQ------RPALPRSVSS 1 MPYTPP+QRSPA+SK NSPILSRNHSY+E G + PQ RP LP S +S Sbjct: 1 MPYTPPSQRSPASSKSNSPILSRNHSYSE----GCLSPQSNSAAHRPVLPHSSTS 51 >ref|XP_008079610.1| hypothetical protein GLAREA_06005 [Glarea lozoyensis ATCC 20868] gi|512204170|gb|EPE32993.1| hypothetical protein GLAREA_06005 [Glarea lozoyensis ATCC 20868] Length = 768 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/48 (62%), Positives = 31/48 (64%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQFPVGPVHPQRPALPRSVS 4 MPYTPPTQRSPA+S P SP LSR SY Q P RP LPRS S Sbjct: 1 MPYTPPTQRSPASSAPQSPALSRRSSYGYQHQSSSPAPTRPELPRSTS 48 >gb|KEF52519.1| hypothetical protein A1O9_11361 [Exophiala aquamarina CBS 119918] Length = 665 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/52 (59%), Positives = 36/52 (69%), Gaps = 3/52 (5%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTE-QF--PVGPVHPQRPALPRSVSS 1 MPYTPP+Q SPA SKP+SP +SR+HSY + QF P P RP LPRS S Sbjct: 1 MPYTPPSQLSPAASKPSSPSVSRSHSYIKGQFLSPEPPASSSRPNLPRSHGS 52 >ref|XP_008718385.1| hypothetical protein HMPREF1541_05826 [Cyphellophora europaea CBS 101466] gi|568116983|gb|ETN39600.1| hypothetical protein HMPREF1541_05826 [Cyphellophora europaea CBS 101466] Length = 664 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/51 (58%), Positives = 34/51 (66%), Gaps = 2/51 (3%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQF--PVGPVHPQRPALPRSVSS 1 MPYTPP Q+SP TSK NSP +SR HSY++ P P H RP LPRS S Sbjct: 1 MPYTPPAQQSPETSKSNSPTISRTHSYSKALLSPELPSH-SRPQLPRSAGS 50 >dbj|GAM90701.1| hypothetical protein ANO11243_087460 [fungal sp. No.11243] Length = 624 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/50 (56%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -1 Query: 147 MPYTPPTQRSPATSKPNSPILSRNHSYTEQF-PVGPVHPQRPALPRSVSS 1 MPYTPP+Q+SPA+SK ++P +SRN SY++ + P H RP LPRS+SS Sbjct: 1 MPYTPPSQQSPASSKSSTPNISRNASYSQDIHALSPSH-NRPTLPRSISS 49