BLASTX nr result
ID: Anemarrhena21_contig00062564
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062564 (368 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tpe|CBF76519.1| TPA: telomere and ribosome associated protein St... 65 2e-08 gb|KKK16663.1| telomere and ribosome associated protein [Aspergi... 61 3e-07 gb|KIV80301.1| hypothetical protein PV11_07814 [Exophiala sideris] 61 3e-07 gb|KIW96378.1| hypothetical protein Z519_03447 [Cladophialophora... 60 4e-07 gb|KIY00233.1| hypothetical protein Z520_03918 [Fonsecaea multim... 60 6e-07 ref|XP_002374688.1| telomere and ribosome associated protein Stm... 60 7e-07 dbj|GAA82093.1| telomere and ribosome associated protein Stm1 [A... 59 1e-06 emb|CRG85915.1| plasminogen activator inhibitor 1 RNA-binding pr... 58 2e-06 gb|KIW25029.1| hypothetical protein PV07_10702 [Cladophialophora... 58 2e-06 gb|KIW16171.1| hypothetical protein PV08_06222 [Exophiala spinif... 58 2e-06 ref|XP_002144001.1| telomere and ribosome associated protein Stm... 58 3e-06 gb|KIX02045.1| hypothetical protein Z518_07984 [Rhinocladiella m... 57 4e-06 ref|XP_002561932.1| Pc18g00860 [Penicillium rubens Wisconsin 54-... 57 5e-06 emb|CDM33923.1| Stm1, N-terminal [Penicillium roqueforti FM164] 57 6e-06 gb|KIW78994.1| hypothetical protein Z517_08834 [Fonsecaea pedros... 57 6e-06 gb|KIW49044.1| hypothetical protein PV05_10760 [Exophiala xenobi... 57 6e-06 gb|EIT76732.1| hypothetical protein Ao3042_07090 [Aspergillus or... 57 6e-06 ref|XP_001399806.1| telomere and ribosome associated protein Stm... 57 6e-06 >tpe|CBF76519.1| TPA: telomere and ribosome associated protein Stm1, putative (AFU_orthologue; AFUA_3G10920) [Aspergillus nidulans FGSC A4] Length = 296 Score = 65.1 bits (157), Expect = 2e-08 Identities = 34/61 (55%), Positives = 39/61 (63%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAAGTTSTRR 22 M+ + SKNL+ELLGN PT+A+DKPA R GKRDAPKEAP R G TS R Sbjct: 1 MADVRSKNLYELLGNDPELDPNREPEPPTRALDKPAPRHGKRDAPKEAPSRPEGQTSRRG 60 Query: 21 P 19 P Sbjct: 61 P 61 >gb|KKK16663.1| telomere and ribosome associated protein [Aspergillus ochraceoroseus] gi|816352796|gb|KKK26871.1| telomere and ribosome associated protein [Aspergillus rambellii] Length = 293 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/59 (54%), Positives = 37/59 (62%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAAGTTSTR 25 M+ + SKNL+ELLGN PTKA+DKP R GKRDAPKEAPVR A + R Sbjct: 1 MADVRSKNLYELLGNDPEFDPNREPEPPTKALDKPVPRHGKRDAPKEAPVRTAESAPRR 59 >gb|KIV80301.1| hypothetical protein PV11_07814 [Exophiala sideris] Length = 387 Score = 60.8 bits (146), Expect = 3e-07 Identities = 34/60 (56%), Positives = 38/60 (63%), Gaps = 1/60 (1%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVR-AAGTTSTR 25 M+ + SKNL+ELLGN PTKAIDKP ARSGKRDAPKEAP G +TR Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPEPPTKAIDKPVARSGKRDAPKEAPAADPIGNVATR 60 >gb|KIW96378.1| hypothetical protein Z519_03447 [Cladophialophora bantiana CBS 173.52] Length = 360 Score = 60.5 bits (145), Expect = 4e-07 Identities = 32/53 (60%), Positives = 35/53 (66%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAA 43 M+ + SKNL+ELLGN PTKAIDKPAAR GKRDAPKEAP A Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPDPPTKAIDKPAARHGKRDAPKEAPAAPA 53 >gb|KIY00233.1| hypothetical protein Z520_03918 [Fonsecaea multimorphosa CBS 102226] Length = 378 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAP 55 M+ + SKNL+ELLGN PTKAIDKP ARSGKRDAPKEAP Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPDPPTKAIDKPVARSGKRDAPKEAP 49 >ref|XP_002374688.1| telomere and ribosome associated protein Stm1, putative [Aspergillus flavus NRRL3357] gi|317143937|ref|XP_001819796.2| telomere and ribosome associated protein Stm1 [Aspergillus oryzae RIB40] gi|220699567|gb|EED55906.1| telomere and ribosome associated protein Stm1, putative [Aspergillus flavus NRRL3357] Length = 285 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/60 (53%), Positives = 38/60 (63%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAAGTTSTRR 22 M+ + SKNL+ELLGN PTKAIDKPA R GKRDAPKEAP + ++RR Sbjct: 1 MADVRSKNLYELLGNDPELDPSRPPAPPTKAIDKPAPRVGKRDAPKEAPSQPRAGQNSRR 60 >dbj|GAA82093.1| telomere and ribosome associated protein Stm1 [Aspergillus kawachii IFO 4308] Length = 301 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/60 (51%), Positives = 38/60 (63%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAAGTTSTRR 22 M+ I SKNL+ELLGN PTKA+D+PA R GKRDAPKEAP + ++RR Sbjct: 1 MAEIRSKNLYELLGNDPELDPNRAPEPPTKAVDRPAPRVGKRDAPKEAPAQPRENNNSRR 60 >emb|CRG85915.1| plasminogen activator inhibitor 1 RNA-binding protein [Talaromyces islandicus] Length = 309 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAP 55 M+ + SKNL+ELLGN PTKA+D+PAAR GKRDAPKEAP Sbjct: 1 MADVRSKNLYELLGNDPELDSDREPEPPTKAVDRPAARHGKRDAPKEAP 49 >gb|KIW25029.1| hypothetical protein PV07_10702 [Cladophialophora immunda] Length = 366 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/49 (61%), Positives = 33/49 (67%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAP 55 M+ + SKNL+ELLGN PTKAIDKP AR GKRDAPKEAP Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPDPPTKAIDKPVARHGKRDAPKEAP 49 >gb|KIW16171.1| hypothetical protein PV08_06222 [Exophiala spinifera] Length = 351 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/52 (57%), Positives = 34/52 (65%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRA 46 M+ + SKNL+ELLGN PTKA+DKPAAR GKRDAPK AP A Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPEPPTKAVDKPAARVGKRDAPKAAPTEA 52 >ref|XP_002144001.1| telomere and ribosome associated protein Stm1, putative [Talaromyces marneffei ATCC 18224] gi|210073399|gb|EEA27486.1| telomere and ribosome associated protein Stm1, putative [Talaromyces marneffei ATCC 18224] gi|679998497|gb|KFX50707.1| Suppressor protein STM1 [Talaromyces marneffei PM1] Length = 309 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/49 (61%), Positives = 33/49 (67%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAP 55 M+ + SKNL+ELLGN PTKAIDKPA R GKRDAPKEAP Sbjct: 1 MADVRSKNLYELLGNDPELDSDREPEPPTKAIDKPAQRHGKRDAPKEAP 49 >gb|KIX02045.1| hypothetical protein Z518_07984 [Rhinocladiella mackenziei CBS 650.93] Length = 839 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/60 (50%), Positives = 35/60 (58%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAAGTTSTRR 22 M+ + SKNL+ELLGN PTKA+DKPAAR GKRDAPK AP + R Sbjct: 483 MADVKSKNLYELLGNTSDQDSDREPDPPTKAVDKPAARHGKRDAPKTAPTEPESVATRGR 542 >ref|XP_002561932.1| Pc18g00860 [Penicillium rubens Wisconsin 54-1255] gi|211586665|emb|CAP94310.1| Pc18g00860 [Penicillium rubens Wisconsin 54-1255] Length = 314 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/59 (50%), Positives = 35/59 (59%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAAGTTSTR 25 M+ + SKNL+ELLGN PTKAID+P RSGKRDAPKE P R + R Sbjct: 1 MADVRSKNLYELLGNDPELDPSRPAPPPTKAIDRPVDRSGKRDAPKEQPARHTEANARR 59 >emb|CDM33923.1| Stm1, N-terminal [Penicillium roqueforti FM164] Length = 316 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/51 (56%), Positives = 33/51 (64%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVR 49 M+ + SKNL+ELLGN PTKAID+P RSGKRDAPKE P R Sbjct: 1 MADVRSKNLYELLGNDPELDPSRPAPPPTKAIDRPVDRSGKRDAPKEQPAR 51 >gb|KIW78994.1| hypothetical protein Z517_08834 [Fonsecaea pedrosoi CBS 271.37] Length = 364 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/49 (59%), Positives = 33/49 (67%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAP 55 M+ + SKNL+ELLGN PTKAIDKP AR GKR+APKEAP Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPEPPTKAIDKPVARHGKREAPKEAP 49 >gb|KIW49044.1| hypothetical protein PV05_10760 [Exophiala xenobiotica] Length = 382 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/59 (49%), Positives = 36/59 (61%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAAGTTSTR 25 M+ + SKNL+ELLGN PTKAIDKPAAR GKR+AP ++P +TR Sbjct: 1 MADVKSKNLYELLGNTSDQDSDREPEPPTKAIDKPAARVGKREAPPQSPAEPLANVATR 59 >gb|EIT76732.1| hypothetical protein Ao3042_07090 [Aspergillus oryzae 3.042] gi|635508528|gb|KDE80512.1| hypothetical protein AO1008_06707 [Aspergillus oryzae 100-8] Length = 285 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/60 (51%), Positives = 37/60 (61%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAAGTTSTRR 22 M+ + SKNL+ELLGN PTKAIDK A R GKRDAPKEAP + ++RR Sbjct: 1 MADVRSKNLYELLGNDPELDPSRPPAPPTKAIDKSAPRVGKRDAPKEAPSQPRAGQNSRR 60 >ref|XP_001399806.1| telomere and ribosome associated protein Stm1 [Aspergillus niger CBS 513.88] gi|134056727|emb|CAK44216.1| unnamed protein product [Aspergillus niger] Length = 303 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/66 (50%), Positives = 40/66 (60%) Frame = -3 Query: 201 MSGIASKNLFELLGNXXXXXXXXXXXXPTKAIDKPAARSGKRDAPKEAPVRAAGTTSTRR 22 M+ I SKNL+ELLGN PTKA+D+PA R GKRDAPKEAP S R Sbjct: 1 MAEIRSKNLYELLGNDPELDPNRAPEPPTKAVDRPAPRVGKRDAPKEAP-------SQPR 53 Query: 21 PDSNNA 4 ++NN+ Sbjct: 54 ENNNNS 59