BLASTX nr result
ID: Anemarrhena21_contig00062515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00062515 (371 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007783188.1| hypothetical protein W97_07368 [Coniosporium... 57 4e-06 >ref|XP_007783188.1| hypothetical protein W97_07368 [Coniosporium apollinis CBS 100218] gi|494831416|gb|EON67871.1| hypothetical protein W97_07368 [Coniosporium apollinis CBS 100218] Length = 400 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/43 (58%), Positives = 34/43 (79%) Frame = -2 Query: 370 LIIFGLLLFTMFVLLGGLAPRFAPEASGKLYDKIGNYVGDKAT 242 LI+FGL++ T+FVL+GGLAPRFAPE S K+G ++GDK + Sbjct: 350 LIVFGLIIVTLFVLMGGLAPRFAPEYSQYAKGKVGEFLGDKGS 392