BLASTX nr result
ID: Anemarrhena21_contig00061523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00061523 (284 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010244619.1| PREDICTED: pentatricopeptide repeat-containi... 47 4e-06 >ref|XP_010244619.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nelumbo nucifera] Length = 666 Score = 47.4 bits (111), Expect(2) = 4e-06 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -2 Query: 115 ALEIFQERG*MDIELNEITFVGLTSACSHRGLLKECQY 2 ALEIF + DI+ NEITF+G+ SACSH GL++E QY Sbjct: 378 ALEIFNDMERYDIKPNEITFLGVLSACSHGGLVQEGQY 415 Score = 29.6 bits (65), Expect(2) = 4e-06 Identities = 15/50 (30%), Positives = 25/50 (50%) Frame = -3 Query: 282 KRVHAYVHQSNIKINFDVLDRHCLICTQKCGLIADACIVFRRIWDGTGVG 133 K VHAY+ + I+++ + + KCG I DA +F+ I +G Sbjct: 311 KWVHAYLSTNKIRLDSGFIGSALIDMYAKCGYIEDAYRIFKSISHRRSIG 360