BLASTX nr result
ID: Anemarrhena21_contig00061282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00061282 (195 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010924658.1| PREDICTED: GATA transcription factor 12-like... 94 5e-17 ref|XP_008804627.1| PREDICTED: GATA transcription factor 9-like ... 94 5e-17 gb|EPS67172.1| hypothetical protein M569_07604, partial [Genlise... 94 5e-17 ref|NP_001159272.1| uncharacterized protein LOC100304362 [Zea ma... 93 8e-17 ref|XP_004969927.1| PREDICTED: GATA transcription factor 12 [Set... 93 8e-17 ref|XP_008655150.1| PREDICTED: uncharacterized protein LOC100304... 93 8e-17 ref|XP_002458475.1| hypothetical protein SORBIDRAFT_03g034360 [S... 93 8e-17 ref|XP_011650196.1| PREDICTED: GATA transcription factor 12-like... 92 1e-16 ref|XP_004291171.2| PREDICTED: GATA transcription factor 12 [Fra... 92 1e-16 ref|XP_012448404.1| PREDICTED: GATA transcription factor 12-like... 92 1e-16 ref|XP_012447956.1| PREDICTED: GATA transcription factor 12-like... 92 1e-16 ref|XP_012477314.1| PREDICTED: GATA transcription factor 12-like... 92 1e-16 ref|XP_011081778.1| PREDICTED: GATA transcription factor 12-like... 92 1e-16 ref|XP_011092007.1| PREDICTED: GATA transcription factor 12 [Ses... 92 1e-16 ref|XP_011014869.1| PREDICTED: GATA transcription factor 12-like... 92 1e-16 ref|XP_010519882.1| PREDICTED: GATA transcription factor 12 [Tar... 92 1e-16 gb|KHG10199.1| GATA transcription factor 12 -like protein [Gossy... 92 1e-16 ref|XP_010493840.1| PREDICTED: GATA transcription factor 12-like... 92 1e-16 ref|XP_010454925.1| PREDICTED: GATA transcription factor 12-like... 92 1e-16 ref|XP_010421443.1| PREDICTED: GATA transcription factor 12 [Cam... 92 1e-16 >ref|XP_010924658.1| PREDICTED: GATA transcription factor 12-like [Elaeis guineensis] Length = 351 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH Sbjct: 259 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 300 >ref|XP_008804627.1| PREDICTED: GATA transcription factor 9-like [Phoenix dactylifera] Length = 363 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH Sbjct: 267 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 308 >gb|EPS67172.1| hypothetical protein M569_07604, partial [Genlisea aurea] Length = 205 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH Sbjct: 114 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 155 >ref|NP_001159272.1| uncharacterized protein LOC100304362 [Zea mays] gi|223943127|gb|ACN25647.1| unknown [Zea mays] Length = 260 Score = 92.8 bits (229), Expect = 8e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFV+SKHSNSH Sbjct: 145 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVMSKHSNSH 186 >ref|XP_004969927.1| PREDICTED: GATA transcription factor 12 [Setaria italica] Length = 399 Score = 92.8 bits (229), Expect = 8e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFV+SKHSNSH Sbjct: 290 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVMSKHSNSH 331 >ref|XP_008655150.1| PREDICTED: uncharacterized protein LOC100304362 isoform X1 [Zea mays] gi|413952458|gb|AFW85107.1| putative GATA transcription factor family protein [Zea mays] gi|645166049|gb|AIB04760.1| C2C2-GATA transcription factor, partial [Zea mays] Length = 375 Score = 92.8 bits (229), Expect = 8e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFV+SKHSNSH Sbjct: 260 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVMSKHSNSH 301 >ref|XP_002458475.1| hypothetical protein SORBIDRAFT_03g034360 [Sorghum bicolor] gi|241930450|gb|EES03595.1| hypothetical protein SORBIDRAFT_03g034360 [Sorghum bicolor] Length = 412 Score = 92.8 bits (229), Expect = 8e-17 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFV+SKHSNSH Sbjct: 301 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVMSKHSNSH 342 >ref|XP_011650196.1| PREDICTED: GATA transcription factor 12-like [Cucumis sativus] Length = 357 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 261 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 302 >ref|XP_004291171.2| PREDICTED: GATA transcription factor 12 [Fragaria vesca subsp. vesca] Length = 461 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 357 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 398 >ref|XP_012448404.1| PREDICTED: GATA transcription factor 12-like [Gossypium raimondii] gi|763798696|gb|KJB65651.1| hypothetical protein B456_010G106100 [Gossypium raimondii] Length = 337 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 247 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 288 >ref|XP_012447956.1| PREDICTED: GATA transcription factor 12-like [Gossypium raimondii] gi|763787805|gb|KJB54801.1| hypothetical protein B456_009G049300 [Gossypium raimondii] Length = 360 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 262 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 303 >ref|XP_012477314.1| PREDICTED: GATA transcription factor 12-like [Gossypium raimondii] gi|763759946|gb|KJB27277.1| hypothetical protein B456_004G288400 [Gossypium raimondii] Length = 363 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 263 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 304 >ref|XP_011081778.1| PREDICTED: GATA transcription factor 12-like [Sesamum indicum] Length = 359 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 259 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 300 >ref|XP_011092007.1| PREDICTED: GATA transcription factor 12 [Sesamum indicum] Length = 352 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 252 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 293 >ref|XP_011014869.1| PREDICTED: GATA transcription factor 12-like [Populus euphratica] Length = 380 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 283 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 324 >ref|XP_010519882.1| PREDICTED: GATA transcription factor 12 [Tarenaya hassleriana] Length = 319 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 227 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 268 >gb|KHG10199.1| GATA transcription factor 12 -like protein [Gossypium arboreum] gi|728831902|gb|KHG11345.1| GATA transcription factor 12 -like protein [Gossypium arboreum] Length = 364 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 263 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 304 >ref|XP_010493840.1| PREDICTED: GATA transcription factor 12-like [Camelina sativa] Length = 333 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 237 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 278 >ref|XP_010454925.1| PREDICTED: GATA transcription factor 12-like [Camelina sativa] Length = 333 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 237 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 278 >ref|XP_010421443.1| PREDICTED: GATA transcription factor 12 [Camelina sativa] Length = 333 Score = 92.4 bits (228), Expect = 1e-16 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = -2 Query: 194 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLSKHSNSH 69 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVL+KHSNSH Sbjct: 237 GPMGPKTLCNACGVRYKSGRLVPEYRPAASPTFVLTKHSNSH 278