BLASTX nr result
ID: Anemarrhena21_contig00060684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00060684 (228 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW07240.1| hypothetical protein PV09_02096 [Verruconis gallo... 82 1e-13 gb|ENI04716.1| hypothetical protein COCC4DRAFT_72537 [Bipolaris ... 80 4e-13 dbj|GAM86424.1| hypothetical protein ANO11243_044380 [fungal sp.... 79 1e-12 ref|XP_007700738.1| hypothetical protein COCSADRAFT_91616 [Bipol... 79 1e-12 ref|XP_008029079.1| hypothetical protein SETTUDRAFT_172987 [Seto... 79 2e-12 gb|EUN31819.1| hypothetical protein COCVIDRAFT_33754 [Bipolaris ... 78 2e-12 ref|XP_007715965.1| hypothetical protein COCCADRAFT_39940 [Bipol... 78 2e-12 gb|KEQ95812.1| hypothetical protein AUEXF2481DRAFT_4767 [Aureoba... 77 3e-12 ref|XP_011109848.1| hypothetical protein H072_3888 [Dactylellina... 77 3e-12 gb|EMD92897.1| hypothetical protein COCHEDRAFT_1133117 [Bipolari... 77 3e-12 ref|XP_001930668.1| hypothetical protein PTRG_00335 [Pyrenophora... 77 3e-12 gb|KEQ88484.1| hypothetical protein M438DRAFT_342079 [Aureobasid... 76 1e-11 ref|XP_003848543.1| hypothetical protein MYCGRDRAFT_88109 [Zymos... 75 1e-11 gb|KEQ77905.1| hypothetical protein M436DRAFT_36503 [Aureobasidi... 74 3e-11 gb|KEQ61621.1| hypothetical protein M437DRAFT_51442 [Aureobasidi... 74 3e-11 gb|KJY02216.1| glucose-repressible protein Grg1 [Zymoseptoria br... 74 4e-11 gb|KEQ63387.1| hypothetical protein M437DRAFT_74644 [Aureobasidi... 73 9e-11 gb|EMF16005.1| hypothetical protein SEPMUDRAFT_124141 [Sphaeruli... 73 9e-11 ref|XP_011117104.1| hypothetical protein AOL_s00004g152 [Arthrob... 72 1e-10 gb|EWC44466.1| hypothetical protein DRE_06734 [Drechslerella ste... 71 2e-10 >gb|KIW07240.1| hypothetical protein PV09_02096 [Verruconis gallopava] Length = 88 Score = 82.4 bits (202), Expect = 1e-13 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPNV+ PNEGIIGQ VNSAKNAVNYVSE+IQG A SKEANKEQAK Sbjct: 1 MSAPNVDKPNEGIIGQAVNSAKNAVNYVSETIQGNAAEASKEANKEQAK 49 >gb|ENI04716.1| hypothetical protein COCC4DRAFT_72537 [Bipolaris maydis ATCC 48331] Length = 292 Score = 80.5 bits (197), Expect = 4e-13 Identities = 38/57 (66%), Positives = 44/57 (77%) Frame = +1 Query: 58 KPNQQESTMSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 K ++ S MSAPN N PNEG++GQ VNS KNA NYVSESIQG A +KEANK+QAK Sbjct: 196 KAHRPHSKMSAPNANTPNEGLVGQAVNSVKNAANYVSESIQGNAAEANKEANKQQAK 252 >dbj|GAM86424.1| hypothetical protein ANO11243_044380 [fungal sp. No.11243] Length = 129 Score = 79.0 bits (193), Expect = 1e-12 Identities = 41/60 (68%), Positives = 44/60 (73%), Gaps = 4/60 (6%) Frame = +1 Query: 61 PNQQEST----MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 PNQ +T MSAPNV+ PNEGI+GQ NS NA NYVSESIQG A SKEANKEQAK Sbjct: 30 PNQSTTTHHITMSAPNVDKPNEGIVGQISNSVSNAANYVSESIQGKSAEASKEANKEQAK 89 >ref|XP_007700738.1| hypothetical protein COCSADRAFT_91616 [Bipolaris sorokiniana ND90Pr] gi|451850402|gb|EMD63704.1| hypothetical protein COCSADRAFT_91616 [Bipolaris sorokiniana ND90Pr] Length = 330 Score = 79.0 bits (193), Expect = 1e-12 Identities = 46/81 (56%), Positives = 53/81 (65%), Gaps = 5/81 (6%) Frame = +1 Query: 1 HQTSLQLSKQLKHLPYT*PKPNQQEST-----MSAPNVNNPNEGIIGQTVNSAKNAVNYV 165 H T++ LS L T NQ +T MSAPN N PNEGI+GQ VNS KNA NYV Sbjct: 214 HHTTINLST----LTSTSFHSNQTLTTNLSTKMSAPNANTPNEGIVGQAVNSVKNAANYV 269 Query: 166 SESIQGAGATTSKEANKEQAK 228 SESIQG+ A +KEANK+QAK Sbjct: 270 SESIQGSTAEANKEANKQQAK 290 >ref|XP_008029079.1| hypothetical protein SETTUDRAFT_172987 [Setosphaeria turcica Et28A] gi|482806263|gb|EOA83336.1| hypothetical protein SETTUDRAFT_172987 [Setosphaeria turcica Et28A] Length = 314 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/57 (64%), Positives = 41/57 (71%) Frame = +1 Query: 58 KPNQQESTMSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 +P MSAPN N PNEGI+GQ NS KNA NYVSESIQG A +KEANK+QAK Sbjct: 218 QPTTPNPKMSAPNANTPNEGILGQAANSVKNAANYVSESIQGTSAEANKEANKQQAK 274 >gb|EUN31819.1| hypothetical protein COCVIDRAFT_33754 [Bipolaris victoriae FI3] Length = 322 Score = 78.2 bits (191), Expect = 2e-12 Identities = 38/56 (67%), Positives = 42/56 (75%) Frame = +1 Query: 61 PNQQESTMSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 P MSAPN N PNEGI+GQ VNS KNA NYVSESIQG+ A +KEANK+QAK Sbjct: 227 PTNLPIKMSAPNANAPNEGIVGQAVNSVKNAANYVSESIQGSTAEANKEANKQQAK 282 >ref|XP_007715965.1| hypothetical protein COCCADRAFT_39940 [Bipolaris zeicola 26-R-13] gi|576915423|gb|EUC29723.1| hypothetical protein COCCADRAFT_39940 [Bipolaris zeicola 26-R-13] Length = 315 Score = 78.2 bits (191), Expect = 2e-12 Identities = 38/56 (67%), Positives = 42/56 (75%) Frame = +1 Query: 61 PNQQESTMSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 P MSAPN N PNEGI+GQ VNS KNA NYVSESIQG+ A +KEANK+QAK Sbjct: 220 PTNLPIKMSAPNANAPNEGIVGQAVNSVKNAANYVSESIQGSTAEANKEANKQQAK 275 >gb|KEQ95812.1| hypothetical protein AUEXF2481DRAFT_4767 [Aureobasidium subglaciale EXF-2481] Length = 180 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/60 (65%), Positives = 45/60 (75%) Frame = +1 Query: 49 T*PKPNQQESTMSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 T P+PN + MSAPN N PNEGI+GQ NS NA YVSE++QG GAT SKEANKE+AK Sbjct: 85 TNPQPNIK---MSAPNANKPNEGIVGQIGNSLNNAAQYVSETVQGTGATASKEANKEKAK 141 >ref|XP_011109848.1| hypothetical protein H072_3888 [Dactylellina haptotyla CBS 200.50] gi|526201692|gb|EPS42146.1| hypothetical protein H072_3888 [Dactylellina haptotyla CBS 200.50] Length = 89 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/49 (73%), Positives = 41/49 (83%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPNVN PNEGI+GQ +NS NA NYVS+++QG GA SKEANKEQAK Sbjct: 1 MSAPNVNKPNEGIVGQAMNSIGNAANYVSDTLQGKGAEASKEANKEQAK 49 >gb|EMD92897.1| hypothetical protein COCHEDRAFT_1133117 [Bipolaris maydis C5] Length = 89 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPN N PNEG++GQ VNS KNA NYVSESIQG A +KEANK+QAK Sbjct: 1 MSAPNANTPNEGLVGQAVNSVKNAANYVSESIQGNAAEANKEANKQQAK 49 >ref|XP_001930668.1| hypothetical protein PTRG_00335 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972274|gb|EDU39773.1| hypothetical protein PTRG_00335 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 89 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPN N PNEGI+GQ VNS KNA NYVSE++QG A SKE+NK+QAK Sbjct: 1 MSAPNANTPNEGIVGQAVNSVKNAANYVSETVQGTSAEASKESNKQQAK 49 >gb|KEQ88484.1| hypothetical protein M438DRAFT_342079 [Aureobasidium pullulans EXF-150] Length = 88 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPN N PNEGI+GQ NS NA YVSE++QGAGAT SKEANKE+AK Sbjct: 1 MSAPNANAPNEGIVGQIGNSLNNAAQYVSETVQGAGATASKEANKEKAK 49 >ref|XP_003848543.1| hypothetical protein MYCGRDRAFT_88109 [Zymoseptoria tritici IPO323] gi|339468418|gb|EGP83519.1| hypothetical protein MYCGRDRAFT_88109 [Zymoseptoria tritici IPO323] Length = 89 Score = 75.5 bits (184), Expect = 1e-11 Identities = 36/49 (73%), Positives = 38/49 (77%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPN N PNEGI+GQ NS NA NYVSES+QG A SKEANKEQAK Sbjct: 1 MSAPNANAPNEGIVGQIANSVSNAANYVSESLQGKSAEASKEANKEQAK 49 >gb|KEQ77905.1| hypothetical protein M436DRAFT_36503 [Aureobasidium namibiae CBS 147.97] Length = 88 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/49 (71%), Positives = 38/49 (77%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPN N PNEGI+GQ NS NA YVSE++QG AT SKEANKEQAK Sbjct: 1 MSAPNANKPNEGIVGQIGNSLNNAAQYVSETVQGTSATASKEANKEQAK 49 >gb|KEQ61621.1| hypothetical protein M437DRAFT_51442 [Aureobasidium melanogenum CBS 110374] Length = 88 Score = 74.3 bits (181), Expect = 3e-11 Identities = 35/49 (71%), Positives = 38/49 (77%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPN N PNEGI+GQ NS NA YVSE++QG AT SKEANKEQAK Sbjct: 1 MSAPNANKPNEGIVGQIGNSLNNAAQYVSETVQGTSATASKEANKEQAK 49 >gb|KJY02216.1| glucose-repressible protein Grg1 [Zymoseptoria brevis] Length = 89 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/49 (71%), Positives = 38/49 (77%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPN N PNEGI+GQ NS NA NYVSES+QG A SKEANKE+AK Sbjct: 1 MSAPNANAPNEGIVGQIANSVSNAANYVSESLQGKSAEASKEANKEKAK 49 >gb|KEQ63387.1| hypothetical protein M437DRAFT_74644 [Aureobasidium melanogenum CBS 110374] Length = 88 Score = 72.8 bits (177), Expect = 9e-11 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPNV+ PNEGI+GQ NS NAVNYVSE+IQG A SKEANK+QAK Sbjct: 1 MSAPNVDKPNEGIVGQISNSIGNAVNYVSETIQGNTAEASKEANKQQAK 49 >gb|EMF16005.1| hypothetical protein SEPMUDRAFT_124141 [Sphaerulina musiva SO2202] Length = 88 Score = 72.8 bits (177), Expect = 9e-11 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPN N PNEGI+GQ NS NA NYV+E++QG A SKEANKEQAK Sbjct: 1 MSAPNANAPNEGIVGQIANSVSNAANYVAETVQGKTAEASKEANKEQAK 49 >ref|XP_011117104.1| hypothetical protein AOL_s00004g152 [Arthrobotrys oligospora ATCC 24927] gi|345571305|gb|EGX54119.1| hypothetical protein AOL_s00004g152 [Arthrobotrys oligospora ATCC 24927] Length = 89 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPNV+ PNEGI+GQ NS KNA NYV+E++QG A SKEANKEQAK Sbjct: 1 MSAPNVDKPNEGIVGQIGNSLKNAGNYVAETVQGKTAEASKEANKEQAK 49 >gb|EWC44466.1| hypothetical protein DRE_06734 [Drechslerella stenobrocha 248] Length = 89 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = +1 Query: 82 MSAPNVNNPNEGIIGQTVNSAKNAVNYVSESIQGAGATTSKEANKEQAK 228 MSAPNVN PNEGI+GQ NS +NA Y+SE+IQG A SKE NKEQAK Sbjct: 1 MSAPNVNKPNEGIVGQIQNSLENAGTYISETIQGKSAEVSKEGNKEQAK 49