BLASTX nr result
ID: Anemarrhena21_contig00060480
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00060480 (269 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63166.1| retrotransposon del1-46, related [Asparagus offic... 65 1e-08 >gb|ABD63166.1| retrotransposon del1-46, related [Asparagus officinalis] Length = 136 Score = 65.5 bits (158), Expect = 1e-08 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (1%) Frame = -1 Query: 158 LRPLQFHGGPDPLVADK*KEDVW-VLDLMDMDTVQCQRLASFTLKGDARKWYR 3 +R +F G DPLVA K KEDV +LD++ +D+VQ QRLAS++LKGDAR+WYR Sbjct: 1 MRAPEFQGSADPLVAHKWKEDVSNILDILSVDSVQKQRLASYSLKGDARRWYR 53