BLASTX nr result
ID: Anemarrhena21_contig00060460
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00060460 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDQ49118.1| hypothetical protein JAAARDRAFT_143849, partial [... 67 5e-09 gb|KDQ05624.1| hypothetical protein BOTBODRAFT_60888 [Botryobasi... 67 5e-09 gb|ENH98551.1| hypothetical protein COCC4DRAFT_155470 [Bipolaris... 67 5e-09 ref|XP_007871309.1| hypothetical protein GLOTRDRAFT_50878, parti... 67 5e-09 ref|XP_007413080.1| hypothetical protein MELLADRAFT_90053 [Melam... 67 5e-09 ref|XP_007415538.1| hypothetical protein MELLADRAFT_92705 [Melam... 67 5e-09 gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trif... 57 6e-06 gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trif... 57 6e-06 >gb|KDQ49118.1| hypothetical protein JAAARDRAFT_143849, partial [Jaapia argillacea MUCL 33604] gi|646383648|gb|KDQ49129.1| hypothetical protein JAAARDRAFT_143868, partial [Jaapia argillacea MUCL 33604] Length = 100 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 SHCVNTVFWPSQCYVLIRQSDSPCPYQF 86 SHCVNT FWPSQCYVLIRQSDSPCPYQF Sbjct: 73 SHCVNTTFWPSQCYVLIRQSDSPCPYQF 100 >gb|KDQ05624.1| hypothetical protein BOTBODRAFT_60888 [Botryobasidium botryosum FD-172 SS1] gi|648151319|gb|KDR65249.1| hypothetical protein GALMADRAFT_82098 [Galerina marginata CBS 339.88] Length = 96 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 SHCVNTVFWPSQCYVLIRQSDSPCPYQF 86 SHCVNT FWPSQCYVLIRQSDSPCPYQF Sbjct: 69 SHCVNTTFWPSQCYVLIRQSDSPCPYQF 96 >gb|ENH98551.1| hypothetical protein COCC4DRAFT_155470 [Bipolaris maydis ATCC 48331] Length = 96 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 SHCVNTVFWPSQCYVLIRQSDSPCPYQF 86 SHCVNT FWPSQCYVLIRQSDSPCPYQF Sbjct: 69 SHCVNTTFWPSQCYVLIRQSDSPCPYQF 96 >ref|XP_007871309.1| hypothetical protein GLOTRDRAFT_50878, partial [Gloeophyllum trabeum ATCC 11539] gi|449539125|gb|EMD30442.1| hypothetical protein CERSUDRAFT_163840, partial [Ceriporiopsis subvermispora B] gi|449540873|gb|EMD31861.1| hypothetical protein CERSUDRAFT_59500, partial [Ceriporiopsis subvermispora B] gi|521719763|gb|EPQ50235.1| hypothetical protein GLOTRDRAFT_50878, partial [Gloeophyllum trabeum ATCC 11539] Length = 64 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 SHCVNTVFWPSQCYVLIRQSDSPCPYQF 86 SHCVNT FWPSQCYVLIRQSDSPCPYQF Sbjct: 37 SHCVNTTFWPSQCYVLIRQSDSPCPYQF 64 >ref|XP_007413080.1| hypothetical protein MELLADRAFT_90053 [Melampsora larici-populina 98AG31] gi|328854501|gb|EGG03633.1| hypothetical protein MELLADRAFT_90053 [Melampsora larici-populina 98AG31] Length = 160 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 SHCVNTVFWPSQCYVLIRQSDSPCPYQF 86 SHCVNT FWPSQCYVLIRQSDSPCPYQF Sbjct: 129 SHCVNTTFWPSQCYVLIRQSDSPCPYQF 156 >ref|XP_007415538.1| hypothetical protein MELLADRAFT_92705 [Melampsora larici-populina 98AG31] gi|328852039|gb|EGG01188.1| hypothetical protein MELLADRAFT_92705 [Melampsora larici-populina 98AG31] Length = 113 Score = 67.0 bits (162), Expect = 5e-09 Identities = 27/28 (96%), Positives = 27/28 (96%) Frame = +3 Query: 3 SHCVNTVFWPSQCYVLIRQSDSPCPYQF 86 SHCVNT FWPSQCYVLIRQSDSPCPYQF Sbjct: 82 SHCVNTTFWPSQCYVLIRQSDSPCPYQF 109 >gb|EJY66653.1| hypothetical protein OXYTRI_13058 [Oxytricha trifallax] Length = 1367 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 1 NHIVSTPFSGHHNAMF*LDSQIPLVRTSSKLVVRCGG 111 NHIVSTPF GHHNA F L+ ++PLVR+SS+ +V C G Sbjct: 373 NHIVSTPFQGHHNAWFLLNCRVPLVRSSSESIVHCSG 409 >gb|EJY65597.1| hypothetical protein OXYTRI_14248 [Oxytricha trifallax] Length = 1367 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/37 (64%), Positives = 30/37 (81%) Frame = +1 Query: 1 NHIVSTPFSGHHNAMF*LDSQIPLVRTSSKLVVRCGG 111 NHIVSTPF GHHNA F L+ ++PLVR+SS+ +V C G Sbjct: 373 NHIVSTPFQGHHNAWFLLNCRVPLVRSSSESIVHCSG 409