BLASTX nr result
ID: Anemarrhena21_contig00060061
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00060061 (309 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010935971.1| PREDICTED: syntaxin-132-like [Elaeis guineen... 59 2e-06 >ref|XP_010935971.1| PREDICTED: syntaxin-132-like [Elaeis guineensis] Length = 306 Score = 58.5 bits (140), Expect = 2e-06 Identities = 32/62 (51%), Positives = 39/62 (62%), Gaps = 5/62 (8%) Frame = -1 Query: 174 LSKFRQESFERIRGRYPGEVD-----GGSVSGSMHGMDGFFKKVAEIEQQMDKINAQLDK 10 ++ ESFER+ GRY GE D G S GMDGFFKKV EIE+Q+++I QL K Sbjct: 1 MNNLMTESFERVIGRYAGEGDIESGNGFSPDARDMGMDGFFKKVGEIEKQIERITTQLHK 60 Query: 9 LQ 4 LQ Sbjct: 61 LQ 62