BLASTX nr result
ID: Anemarrhena21_contig00059965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00059965 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO86875.1| hypothetical protein CISIN_1g026531mg [Citrus sin... 58 3e-06 >gb|KDO86875.1| hypothetical protein CISIN_1g026531mg [Citrus sinensis] Length = 237 Score = 57.8 bits (138), Expect = 3e-06 Identities = 41/84 (48%), Positives = 49/84 (58%), Gaps = 6/84 (7%) Frame = +3 Query: 3 SPDYSPDVKFYKVEAIMR*K-----NLRKITNSLFLCGGFSSFMIFA-HFISQLVLPYGE 164 SPDY PD KFYKVEAI+R + L + L L F S ++ + +F L+L G Sbjct: 59 SPDYIPDSKFYKVEAILRYEVQVLVKLGLLLLLLLLFPFFPSPLLSSMYFFFHLLLISG- 117 Query: 165 FAR*RPWRVPHVSSGLLKMGIRGV 236 R RPWRV VSS LL MGIRGV Sbjct: 118 --RIRPWRVQQVSSALLNMGIRGV 139