BLASTX nr result
ID: Anemarrhena21_contig00059884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00059884 (225 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIW74059.1| plasma membrane proteolipid 3 [Fonsecaea pedrosoi... 80 5e-13 ref|XP_007725861.1| plasma membrane proteolipid 3 [Capronia coro... 80 5e-13 ref|XP_007746200.1| plasma membrane proteolipid 3 [Cladophialoph... 80 5e-13 ref|XP_007761856.1| plasma membrane proteolipid 3 [Cladophialoph... 80 5e-13 ref|XP_008715450.1| plasma membrane proteolipid 3 [Cyphellophora... 80 5e-13 ref|XP_008731138.1| plasma membrane proteolipid 3 [Cladophialoph... 80 7e-13 gb|KDE06194.1| hypothetical protein MVLG_03475 [Microbotryum vio... 78 2e-12 gb|EMS19696.1| stress response RCI peptide, putative [Rhodospori... 78 3e-12 gb|KFA66992.1| hypothetical protein S40285_06252 [Stachybotrys c... 77 4e-12 ref|XP_003661311.1| hypothetical protein MYCTH_2314489 [Myceliop... 77 4e-12 ref|XP_011319169.1| hypothetical protein FGSG_10222 [Fusarium gr... 77 6e-12 ref|XP_009255045.1| hypothetical protein FPSE_03651 [Fusarium ps... 77 6e-12 ref|XP_003842318.1| hypothetical protein LEMA_P080780.1 [Leptosp... 77 6e-12 ref|XP_008099078.1| hypothetical protein GLRG_10202 [Colletotric... 77 6e-12 gb|KIM49218.1| hypothetical protein M413DRAFT_21480 [Hebeloma cy... 76 8e-12 ref|XP_011106806.1| hypothetical protein H072_814 [Dactylellina ... 76 8e-12 ref|XP_007598233.1| plasma membrane proteolipid 3 [Colletotrichu... 76 8e-12 dbj|GAA94872.1| hypothetical protein E5Q_01526 [Mixia osmundae I... 76 1e-11 gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxyspor... 76 1e-11 gb|KDQ33210.1| hypothetical protein PLEOSDRAFT_185721 [Pleurotus... 75 1e-11 >gb|KIW74059.1| plasma membrane proteolipid 3 [Fonsecaea pedrosoi CBS 271.37] Length = 75 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPPLGVFLERGCNADFFINILLTI Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLTI 40 >ref|XP_007725861.1| plasma membrane proteolipid 3 [Capronia coronata CBS 617.96] gi|590007968|gb|EXJ83175.1| plasma membrane proteolipid 3 [Capronia coronata CBS 617.96] Length = 64 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPPLGVFLERGCNADFFINILLTI Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLTI 40 >ref|XP_007746200.1| plasma membrane proteolipid 3 [Cladophialophora psammophila CBS 110553] gi|589986401|gb|EXJ69385.1| plasma membrane proteolipid 3 [Cladophialophora psammophila CBS 110553] gi|759206605|gb|KIV84024.1| plasma membrane proteolipid 3 [Exophiala sideris] gi|759220337|gb|KIV97674.1| plasma membrane proteolipid 3 [Exophiala mesophila] gi|759237435|gb|KIW14380.1| plasma membrane proteolipid 3 [Exophiala spinifera] gi|759281741|gb|KIW58244.1| plasma membrane proteolipid 3 [Exophiala xenobiotica] gi|759317039|gb|KIW93388.1| plasma membrane proteolipid 3 [Cladophialophora bantiana CBS 173.52] gi|759329120|gb|KIX05448.1| plasma membrane proteolipid 3 [Rhinocladiella mackenziei CBS 650.93] gi|761334827|gb|KIX96385.1| plasma membrane proteolipid 3 [Fonsecaea multimorphosa CBS 102226] Length = 57 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPPLGVFLERGCNADFFINILLTI Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLTI 40 >ref|XP_007761856.1| plasma membrane proteolipid 3 [Cladophialophora yegresii CBS 114405] gi|589970983|gb|EXJ54341.1| plasma membrane proteolipid 3 [Cladophialophora yegresii CBS 114405] Length = 79 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPPLGVFLERGCNADFFINILLTI Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLTI 40 >ref|XP_008715450.1| plasma membrane proteolipid 3 [Cyphellophora europaea CBS 101466] gi|568121112|gb|ETN43714.1| plasma membrane proteolipid 3 [Cyphellophora europaea CBS 101466] Length = 51 Score = 80.1 bits (196), Expect = 5e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPPLGVFLERGCNADFFINILLTI Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFFINILLTI 40 >ref|XP_008731138.1| plasma membrane proteolipid 3 [Cladophialophora carrionii CBS 160.54] gi|565931262|gb|ETI20570.1| plasma membrane proteolipid 3 [Cladophialophora carrionii CBS 160.54] Length = 79 Score = 79.7 bits (195), Expect = 7e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPPLGVFLERGCNADFFINILLTI Sbjct: 1 MPFTASDICKIILAIVLPPLGVFLERGCNADFFINILLTI 40 >gb|KDE06194.1| hypothetical protein MVLG_03475 [Microbotryum violaceum p1A1 Lamole] Length = 122 Score = 78.2 bits (191), Expect = 2e-12 Identities = 41/65 (63%), Positives = 47/65 (72%), Gaps = 4/65 (6%) Frame = -2 Query: 185 PATRS--PSVDYLSSQKQAATTN--MPFTASDICKFIVAILLPPLGVFLERGCNADFFIN 18 P TR PS+ S Q + MPFTASDICK I+AI LPPLGVFLERGCNADF+IN Sbjct: 41 PLTRCTPPSLQVTSHQSLCPNNSSAMPFTASDICKIILAIFLPPLGVFLERGCNADFWIN 100 Query: 17 ILLTI 3 ++LTI Sbjct: 101 VILTI 105 >gb|EMS19696.1| stress response RCI peptide, putative [Rhodosporidium toruloides NP11] gi|647395037|emb|CDR36273.1| RHTO0S01e18030g1_1 [Rhodosporidium toruloides] Length = 57 Score = 77.8 bits (190), Expect = 3e-12 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPPLGVFLERGCNADF+IN+LLTI Sbjct: 1 MPFTASDICKIILAIILPPLGVFLERGCNADFWINVLLTI 40 >gb|KFA66992.1| hypothetical protein S40285_06252 [Stachybotrys chlorohalonata IBT 40285] Length = 57 Score = 77.0 bits (188), Expect = 4e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+A+LLPP+GVFLERGC ADFFINILLTI Sbjct: 1 MPFTASDICKIILAVLLPPVGVFLERGCGADFFINILLTI 40 >ref|XP_003661311.1| hypothetical protein MYCTH_2314489 [Myceliophthora thermophila ATCC 42464] gi|347008579|gb|AEO56066.1| hypothetical protein MYCTH_2314489 [Myceliophthora thermophila ATCC 42464] Length = 57 Score = 77.0 bits (188), Expect = 4e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MP TASDICK I AI+LPPLGVFLERGCNADFFINILLTI Sbjct: 1 MPLTASDICKIIFAIILPPLGVFLERGCNADFFINILLTI 40 >ref|XP_011319169.1| hypothetical protein FGSG_10222 [Fusarium graminearum PH-1] gi|410516918|sp|Q4HXT6.2|PMP3_GIBZE RecName: Full=Plasma membrane proteolipid 3 gi|558866824|gb|ESU16907.1| hypothetical protein FGSG_10222 [Fusarium graminearum PH-1] gi|596545806|gb|EYB25849.1| hypothetical protein FG05_10222 [Fusarium graminearum] gi|699044605|emb|CEF75592.1| unnamed protein product [Fusarium graminearum] Length = 57 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPP+GVFLERGC ADFFINILLTI Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFFINILLTI 40 >ref|XP_009255045.1| hypothetical protein FPSE_03651 [Fusarium pseudograminearum CS3096] gi|408397025|gb|EKJ76176.1| hypothetical protein FPSE_03651 [Fusarium pseudograminearum CS3096] Length = 94 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPP+GVFLERGC ADFFINILLTI Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFFINILLTI 40 >ref|XP_003842318.1| hypothetical protein LEMA_P080780.1 [Leptosphaeria maculans JN3] gi|312218894|emb|CBX98839.1| hypothetical protein LEMA_P080780.1 [Leptosphaeria maculans JN3] Length = 131 Score = 76.6 bits (187), Expect = 6e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK ++AI+LPPLGVFLERGCNADF INILLT+ Sbjct: 1 MPFTASDICKILLAIILPPLGVFLERGCNADFLINILLTV 40 >ref|XP_008099078.1| hypothetical protein GLRG_10202 [Colletotrichum graminicola M1.001] gi|310800165|gb|EFQ35058.1| hypothetical protein GLRG_10202 [Colletotrichum graminicola M1.001] gi|530463481|gb|EQB46149.1| hypothetical protein CGLO_14841 [Colletotrichum gloeosporioides Cg-14] gi|640924637|gb|KDN68644.1| hypothetical protein CSUB01_03103 [Colletotrichum sublineola] Length = 57 Score = 76.6 bits (187), Expect = 6e-12 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPP+GVFLERGC ADFFINILLTI Sbjct: 1 MPFTASDICKIILAIILPPVGVFLERGCGADFFINILLTI 40 >gb|KIM49218.1| hypothetical protein M413DRAFT_21480 [Hebeloma cylindrosporum h7] Length = 57 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 M FTASDICK I+AI LPPLGVFLERGCNADFFINILLTI Sbjct: 1 MAFTASDICKIILAIFLPPLGVFLERGCNADFFINILLTI 40 >ref|XP_011106806.1| hypothetical protein H072_814 [Dactylellina haptotyla CBS 200.50] gi|526205025|gb|EPS45192.1| hypothetical protein H072_814 [Dactylellina haptotyla CBS 200.50] Length = 57 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI+LPPLGVFLERGC ADF+IN+LLTI Sbjct: 1 MPFTASDICKIIIAIILPPLGVFLERGCTADFWINVLLTI 40 >ref|XP_007598233.1| plasma membrane proteolipid 3 [Colletotrichum fioriniae PJ7] gi|380488434|emb|CCF37378.1| plasma membrane proteolipid 3 [Colletotrichum higginsianum] gi|588896715|gb|EXF78143.1| plasma membrane proteolipid 3 [Colletotrichum fioriniae PJ7] gi|666406799|gb|KEY72023.1| hypothetical protein S7711_00042 [Stachybotrys chartarum IBT 7711] Length = 57 Score = 76.3 bits (186), Expect = 8e-12 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+A++LPP+GVFLERGC ADFFINILLTI Sbjct: 1 MPFTASDICKIILAVILPPVGVFLERGCGADFFINILLTI 40 >dbj|GAA94872.1| hypothetical protein E5Q_01526 [Mixia osmundae IAM 14324] Length = 111 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK I+AI +PPLGVFLERGCNADF+IN+LLTI Sbjct: 1 MPFTASDICKIILAIFVPPLGVFLERGCNADFWINVLLTI 40 >gb|EGU82857.1| hypothetical protein FOXB_06660 [Fusarium oxysporum Fo5176] gi|517317170|emb|CCT69344.1| probable RIC1 protein [Fusarium fujikuroi IMI 58289] gi|584131311|gb|EWG40705.1| plasma membrane proteolipid 3 [Fusarium verticillioides 7600] gi|587668050|gb|EWY90391.1| plasma membrane proteolipid 3 [Fusarium oxysporum FOSC 3-a] gi|587690392|gb|EWZ36997.1| plasma membrane proteolipid 3 [Fusarium oxysporum Fo47] gi|587719003|gb|EWZ90340.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. lycopersici MN25] gi|587746858|gb|EXA44574.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. pisi HDV247] gi|590037174|gb|EXK39032.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. melonis 26406] gi|590063000|gb|EXK90524.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. raphani 54005] gi|591421327|gb|EXL56464.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] gi|591452771|gb|EXL85065.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. conglutinans race 2 54008] gi|591470692|gb|EXM01996.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] gi|591503744|gb|EXM33089.1| plasma membrane proteolipid 3 [Fusarium oxysporum f. sp. vasinfectum 25433] gi|829110287|gb|KLO86824.1| putative RIC1 protein [Fusarium fujikuroi] gi|829112645|gb|KLO89093.1| Uncharacterized protein LW93_12514 [Fusarium fujikuroi] gi|829142269|gb|KLP14054.1| Uncharacterized protein LW94_7022 [Fusarium fujikuroi] Length = 57 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK ++AI+LPP+GVFLERGC ADFFINILLTI Sbjct: 1 MPFTASDICKILLAIILPPVGVFLERGCGADFFINILLTI 40 >gb|KDQ33210.1| hypothetical protein PLEOSDRAFT_185721 [Pleurotus ostreatus PC15] Length = 57 Score = 75.5 bits (184), Expect = 1e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -2 Query: 122 MPFTASDICKFIVAILLPPLGVFLERGCNADFFINILLTI 3 MPFTASDICK + AI LPPLGVFLERGCNADF INILLTI Sbjct: 1 MPFTASDICKILFAIFLPPLGVFLERGCNADFLINILLTI 40