BLASTX nr result
ID: Anemarrhena21_contig00059822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00059822 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD63174.1| hypothetical protein 20.t00026 [Asparagus officin... 58 2e-07 >gb|ABD63174.1| hypothetical protein 20.t00026 [Asparagus officinalis] Length = 903 Score = 57.8 bits (138), Expect(2) = 2e-07 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 1/74 (1%) Frame = -2 Query: 233 YPMACFVLHCLSLMSAPPHSTKAFTPYLQRLEGSNLVHKYIADMRKSLAKPRNFRLFRCL 54 Y MA +VLHC +LMSA +F P++QRLE + V Y+ +R+ LA+ NF ++RC Sbjct: 22 YLMAWYVLHCPTLMSAASPPEDSFIPFVQRLESAKWVGGYMVRIRQILARDTNFHIYRCF 81 Query: 53 SPSRAN-YGQSFRD 15 YG ++D Sbjct: 82 PDFEGGVYGAEYQD 95 Score = 23.9 bits (50), Expect(2) = 2e-07 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 261 PRVPLPYTYL 232 PRVP+PY YL Sbjct: 14 PRVPMPYAYL 23