BLASTX nr result
ID: Anemarrhena21_contig00059667
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00059667 (371 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008779530.1| PREDICTED: uncharacterized protein LOC103699... 46 2e-08 >ref|XP_008779530.1| PREDICTED: uncharacterized protein LOC103699270, partial [Phoenix dactylifera] Length = 1140 Score = 46.2 bits (108), Expect(2) = 2e-08 Identities = 24/54 (44%), Positives = 32/54 (59%) Frame = -2 Query: 289 PILVGDRLSTLAKFFAQHLQELHGNIKW*IEGNNDTYKSFIDLHK*L*EFAVGE 128 P+ +R+S A+ FAQH+Q LH I IE NN YK +DL + EF VG+ Sbjct: 894 PVAPNNRISETAESFAQHMQNLHKEINKKIEINNARYKMAVDLRRRYQEFRVGD 947 Score = 38.9 bits (89), Expect(2) = 2e-08 Identities = 17/37 (45%), Positives = 25/37 (67%) Frame = -1 Query: 134 GRGLMVRVNPKRFFLGILKKQHARRIGP*SVLKRFSS 24 G +M+R+ P+RF G ++K HAR +GP +LKR S Sbjct: 946 GDDVMIRIRPERFPPGTVRKLHARSMGPYKILKRVGS 982