BLASTX nr result
ID: Anemarrhena21_contig00059436
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00059436 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW83129.1| hypothetical protein ZEAMMB73_669042 [Zea mays] 59 1e-06 ref|XP_009400520.1| PREDICTED: arabinogalactan peptide 22-like [... 57 5e-06 >gb|AFW83129.1| hypothetical protein ZEAMMB73_669042 [Zea mays] Length = 67 Score = 59.3 bits (142), Expect = 1e-06 Identities = 32/58 (55%), Positives = 40/58 (68%), Gaps = 8/58 (13%) Frame = -3 Query: 178 LAYLILSTIVNPCFCQEDAYYAP--------KSDAKAIDQGVAYVLMAIALMVTYLVH 29 LAYL+L+T+++PC C A AP + D KAIDQGVAYVLM +AL VTY+VH Sbjct: 11 LAYLLLATLLHPCLCHAAAA-APAARGAGNWRMDPKAIDQGVAYVLMLLALFVTYIVH 67 >ref|XP_009400520.1| PREDICTED: arabinogalactan peptide 22-like [Musa acuminata subsp. malaccensis] Length = 67 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/67 (44%), Positives = 42/67 (62%), Gaps = 6/67 (8%) Frame = -3 Query: 211 MSSAGVPAAFFLAYLILSTIVNPCFCQ------EDAYYAPKSDAKAIDQGVAYVLMAIAL 50 M+ A A LAY++++ + +P Q D+ A + D KAIDQG+AYVLM +AL Sbjct: 1 MACASKMRALLLAYVLIAVLFHPLLSQGVMASPADSTTAKRIDGKAIDQGIAYVLMLVAL 60 Query: 49 MVTYLVH 29 +VTYLVH Sbjct: 61 LVTYLVH 67