BLASTX nr result
ID: Anemarrhena21_contig00059097
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00059097 (248 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010645086.1| PREDICTED: uncharacterized protein LOC104877... 77 6e-12 ref|NP_680299.4| hAT family dimerization domain-containing prote... 77 6e-12 ref|XP_010659119.1| PREDICTED: uncharacterized protein LOC104881... 76 8e-12 ref|XP_009797978.1| PREDICTED: uncharacterized protein LOC104244... 75 2e-11 ref|XP_009587540.1| PREDICTED: uncharacterized protein LOC104085... 75 2e-11 emb|CDX98337.1| BnaC06g16980D [Brassica napus] 75 2e-11 emb|CDY63174.1| BnaC02g47840D [Brassica napus] 75 2e-11 ref|XP_010490147.1| PREDICTED: uncharacterized protein LOC104767... 75 2e-11 ref|XP_010312179.1| PREDICTED: uncharacterized protein LOC104644... 75 2e-11 ref|XP_010321960.1| PREDICTED: uncharacterized protein LOC104647... 75 2e-11 emb|CDY50682.1| BnaA08g29420D [Brassica napus] 75 2e-11 ref|XP_009601467.1| PREDICTED: uncharacterized protein LOC104096... 74 2e-11 ref|XP_009625422.1| PREDICTED: uncharacterized protein LOC104116... 74 2e-11 ref|XP_009599664.1| PREDICTED: uncharacterized protein LOC104095... 74 3e-11 ref|XP_010645756.1| PREDICTED: uncharacterized protein LOC100262... 74 3e-11 ref|XP_010662213.1| PREDICTED: uncharacterized protein LOC104882... 74 3e-11 ref|XP_010660195.1| PREDICTED: uncharacterized protein LOC104881... 74 3e-11 ref|XP_010658045.1| PREDICTED: uncharacterized protein LOC100250... 74 3e-11 ref|XP_010655899.1| PREDICTED: uncharacterized protein LOC104880... 74 3e-11 ref|XP_010653018.1| PREDICTED: uncharacterized protein LOC104879... 74 3e-11 >ref|XP_010645086.1| PREDICTED: uncharacterized protein LOC104877793 [Vitis vinifera] Length = 198 Score = 76.6 bits (187), Expect = 6e-12 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WW+AYG+S P LQRFAIKVL+LTCS+SGCERNWS+FE Sbjct: 151 AEWWAAYGASAPNLQRFAIKVLNLTCSASGCERNWSIFE 189 >ref|NP_680299.4| hAT family dimerization domain-containing protein [Arabidopsis thaliana] gi|332006519|gb|AED93902.1| hAT family dimerization domain-containing protein [Arabidopsis thaliana] Length = 509 Score = 76.6 bits (187), Expect = 6e-12 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WWSAYGSSTP LQ FAIKVLSLTCS++GCERNW VF+ Sbjct: 215 AEWWSAYGSSTPNLQNFAIKVLSLTCSATGCERNWGVFQ 253 >ref|XP_010659119.1| PREDICTED: uncharacterized protein LOC104881269 [Vitis vinifera] Length = 297 Score = 76.3 bits (186), Expect = 8e-12 Identities = 30/39 (76%), Positives = 38/39 (97%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WW+AYG+STP LQ+FA+KVL+LTCS+SGCERNWS+FE Sbjct: 248 AEWWAAYGASTPNLQKFAMKVLNLTCSASGCERNWSIFE 286 >ref|XP_009797978.1| PREDICTED: uncharacterized protein LOC104244287 [Nicotiana sylvestris] Length = 213 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 134 DWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 +WW YG STP LQ+FAIKVLSLTCSSSGCERNWSVFE Sbjct: 42 EWWKQYGHSTPDLQKFAIKVLSLTCSSSGCERNWSVFE 79 >ref|XP_009587540.1| PREDICTED: uncharacterized protein LOC104085248 [Nicotiana tomentosiformis] Length = 217 Score = 75.1 bits (183), Expect = 2e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 134 DWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 +WW YG STP LQ+FAIKVLSLTCSSSGCERNWSVFE Sbjct: 42 EWWKQYGHSTPELQKFAIKVLSLTCSSSGCERNWSVFE 79 >emb|CDX98337.1| BnaC06g16980D [Brassica napus] Length = 213 Score = 75.1 bits (183), Expect = 2e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 ADWWS+YGSS P L+ FA+KVLSLTCS+SGCERNWSVF+ Sbjct: 12 ADWWSSYGSSAPNLRDFAVKVLSLTCSASGCERNWSVFQ 50 >emb|CDY63174.1| BnaC02g47840D [Brassica napus] Length = 411 Score = 75.1 bits (183), Expect = 2e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 ADWWS+YGSS P L+ FA+KVLSLTCS+SGCERNWSVF+ Sbjct: 210 ADWWSSYGSSAPNLRDFAVKVLSLTCSASGCERNWSVFQ 248 >ref|XP_010490147.1| PREDICTED: uncharacterized protein LOC104767878 [Camelina sativa] Length = 422 Score = 74.7 bits (182), Expect(2) = 2e-11 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WWS+YG STPTL+ FA+KVLSLTCS++GCERNWSVF+ Sbjct: 214 AEWWSSYGGSTPTLRDFAVKVLSLTCSATGCERNWSVFQ 252 Score = 20.4 bits (41), Expect(2) = 2e-11 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +1 Query: 7 MTRRQRKSKAP 39 M +RQRK KAP Sbjct: 203 MAKRQRKLKAP 213 >ref|XP_010312179.1| PREDICTED: uncharacterized protein LOC104644374 [Solanum lycopersicum] Length = 403 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 134 DWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 +WWS +GS TP LQ+FA+KVLSLTCSSSGCERNWSVFE Sbjct: 216 EWWSLFGSETPNLQKFAMKVLSLTCSSSGCERNWSVFE 253 >ref|XP_010321960.1| PREDICTED: uncharacterized protein LOC104647830 [Solanum lycopersicum] Length = 219 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +2 Query: 134 DWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 +WWS +GS TP LQ+FA+KVLSLTCSSSGCERNWSVFE Sbjct: 22 EWWSLFGSETPNLQKFAMKVLSLTCSSSGCERNWSVFE 59 >emb|CDY50682.1| BnaA08g29420D [Brassica napus] Length = 329 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 ADWWS+YGSS PTL+ F +KVLSLTCS+SGCERNWSVF+ Sbjct: 128 ADWWSSYGSSAPTLRDFNVKVLSLTCSASGCERNWSVFQ 166 >ref|XP_009601467.1| PREDICTED: uncharacterized protein LOC104096761 isoform X1 [Nicotiana tomentosiformis] Length = 787 Score = 73.9 bits (180), Expect(2) = 2e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 134 DWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 +WW YG STP LQ+F+IKVLSLTCSSSGCERNWSVFE Sbjct: 611 EWWKQYGHSTPDLQKFSIKVLSLTCSSSGCERNWSVFE 648 Score = 20.8 bits (42), Expect(2) = 2e-11 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 7 MTRRQRKSKAPG 42 M RQRK+K+PG Sbjct: 570 MAIRQRKTKSPG 581 >ref|XP_009625422.1| PREDICTED: uncharacterized protein LOC104116303 isoform X1 [Nicotiana tomentosiformis] Length = 673 Score = 73.9 bits (180), Expect(2) = 2e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 134 DWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 +WW YG STP LQ+F+IKVLSLTCSSSGCERNWSVFE Sbjct: 497 EWWKQYGHSTPDLQKFSIKVLSLTCSSSGCERNWSVFE 534 Score = 20.8 bits (42), Expect(2) = 2e-11 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 7 MTRRQRKSKAPG 42 M RQRK+K+PG Sbjct: 456 MAIRQRKTKSPG 467 >ref|XP_009599664.1| PREDICTED: uncharacterized protein LOC104095281 isoform X1 [Nicotiana tomentosiformis] Length = 338 Score = 73.9 bits (180), Expect(2) = 3e-11 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 134 DWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 +WW YG STP LQ+F+IKVLSLTCSSSGCERNWSVFE Sbjct: 245 EWWKQYGHSTPDLQKFSIKVLSLTCSSSGCERNWSVFE 282 Score = 20.8 bits (42), Expect(2) = 3e-11 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +1 Query: 7 MTRRQRKSKAPG 42 M RQRK+K+PG Sbjct: 204 MAIRQRKTKSPG 215 >ref|XP_010645756.1| PREDICTED: uncharacterized protein LOC100262277 [Vitis vinifera] Length = 504 Score = 74.3 bits (181), Expect = 3e-11 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WW+AYG+S P LQ+FA+KVL+LTCS+SGCERNWS+FE Sbjct: 415 AEWWAAYGASAPNLQKFAMKVLNLTCSTSGCERNWSIFE 453 >ref|XP_010662213.1| PREDICTED: uncharacterized protein LOC104882034 [Vitis vinifera] Length = 643 Score = 74.3 bits (181), Expect = 3e-11 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WW+AYG+S P LQ+FA+KVL+LTCS+SGCERNWS+FE Sbjct: 371 AEWWAAYGASAPNLQKFAMKVLNLTCSASGCERNWSIFE 409 >ref|XP_010660195.1| PREDICTED: uncharacterized protein LOC104881492 [Vitis vinifera] Length = 431 Score = 74.3 bits (181), Expect = 3e-11 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WW+AYG+S P LQ+FA+KVL+LTCS+SGCERNWS+FE Sbjct: 382 AEWWAAYGASAPNLQKFAMKVLNLTCSASGCERNWSIFE 420 >ref|XP_010658045.1| PREDICTED: uncharacterized protein LOC100250477 [Vitis vinifera] Length = 505 Score = 74.3 bits (181), Expect = 3e-11 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WW+AYG+S P LQ+FA+KVL+LTCS+SGCERNWS+FE Sbjct: 456 AEWWAAYGASAPNLQKFAMKVLNLTCSASGCERNWSIFE 494 >ref|XP_010655899.1| PREDICTED: uncharacterized protein LOC104880586 isoform X2 [Vitis vinifera] Length = 226 Score = 74.3 bits (181), Expect = 3e-11 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WW+AYG+S P LQ+FA+KVL+LTCS+SGCERNWS+FE Sbjct: 177 AEWWAAYGASAPNLQKFAMKVLNLTCSASGCERNWSIFE 215 >ref|XP_010653018.1| PREDICTED: uncharacterized protein LOC104879951 [Vitis vinifera] Length = 530 Score = 74.3 bits (181), Expect = 3e-11 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = +2 Query: 131 ADWWSAYGSSTPTLQRFAIKVLSLTCSSSGCERNWSVFE 247 A+WW+AYG+S P LQ+FA+KVL+LTCS+SGCERNWS+FE Sbjct: 215 AEWWAAYGASAPNLQKFAMKVLNLTCSASGCERNWSIFE 253