BLASTX nr result
ID: Anemarrhena21_contig00059016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00059016 (364 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010258133.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 58 3e-06 ref|XP_010939533.1| PREDICTED: CLAVATA3/ESR (CLE)-related protei... 57 6e-06 >ref|XP_010258133.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 10-like [Nelumbo nucifera] Length = 109 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/49 (59%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Frame = +1 Query: 226 NSWCHQNY---LAHRSDRLHEPRPQAPPFEDEIDPRYGVEKRLVPTGPN 363 NS+ Q Y L + RLH P P DEIDPRYGVEKRLVPTGPN Sbjct: 57 NSFSSQRYPPSLCFQPKRLHRQPPPPSPLNDEIDPRYGVEKRLVPTGPN 105 >ref|XP_010939533.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 9-like [Elaeis guineensis] Length = 120 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/45 (64%), Positives = 31/45 (68%) Frame = +1 Query: 229 SWCHQNYLAHRSDRLHEPRPQAPPFEDEIDPRYGVEKRLVPTGPN 363 SWC L RL +P P PP E+EIDPRYGVEKRLVPTGPN Sbjct: 77 SWC----LPFPRGRL-QPLPPPPPMEEEIDPRYGVEKRLVPTGPN 116