BLASTX nr result
ID: Anemarrhena21_contig00058701
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00058701 (244 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535493.1| conserved hypothetical protein [Ricinus comm... 64 5e-08 ref|XP_002538835.1| conserved hypothetical protein [Ricinus comm... 64 5e-08 gb|KMT18381.1| hypothetical protein BVRB_2g025340 [Beta vulgaris... 62 1e-07 ref|XP_003594532.1| Zinc finger protein GIS2 [Medicago truncatula] 60 7e-07 >ref|XP_002535493.1| conserved hypothetical protein [Ricinus communis] gi|223522917|gb|EEF26889.1| conserved hypothetical protein [Ricinus communis] Length = 339 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/57 (52%), Positives = 42/57 (73%) Frame = -1 Query: 226 AAEFQKQRDRRHLFHFTMRLRPEFEAVRSNILHRQPLPTLNEAVAEFISEETRLGML 56 A + QK RD++ LF F M LR EFE++R +LH+ PLPTL+ A++E I+EE RL +L Sbjct: 13 AKKQQKARDQQRLFQFLMHLRLEFESIRGQLLHKSPLPTLDVALSELIAEEIRLRVL 69 >ref|XP_002538835.1| conserved hypothetical protein [Ricinus communis] gi|223510211|gb|EEF23548.1| conserved hypothetical protein, partial [Ricinus communis] Length = 92 Score = 63.5 bits (153), Expect = 5e-08 Identities = 30/57 (52%), Positives = 42/57 (73%) Frame = -1 Query: 226 AAEFQKQRDRRHLFHFTMRLRPEFEAVRSNILHRQPLPTLNEAVAEFISEETRLGML 56 A + QK RD++ LF F M LR EFE++R +LH+ PLPTL+ A++E I+EE RL +L Sbjct: 13 AKKQQKARDQQRLFQFLMHLRLEFESIRGQLLHKSPLPTLDVALSELIAEEIRLRVL 69 >gb|KMT18381.1| hypothetical protein BVRB_2g025340 [Beta vulgaris subsp. vulgaris] Length = 317 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/57 (50%), Positives = 38/57 (66%) Frame = -1 Query: 226 AAEFQKQRDRRHLFHFTMRLRPEFEAVRSNILHRQPLPTLNEAVAEFISEETRLGML 56 AA F RDR+ + F M L ++E +R ++LHR+ PTL VAE +SEETRLGML Sbjct: 157 AANFYGYRDRQRVMQFLMALESDYENLRGSLLHRETFPTLESVVAELLSEETRLGML 213 >ref|XP_003594532.1| Zinc finger protein GIS2 [Medicago truncatula] Length = 499 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/48 (56%), Positives = 35/48 (72%) Frame = -1 Query: 202 DRRHLFHFTMRLRPEFEAVRSNILHRQPLPTLNEAVAEFISEETRLGM 59 D HL M LRPE+EAVR+++LHR PLP+L+ A+ E I EETRL + Sbjct: 44 DHLHLIQVLMTLRPEYEAVRASLLHRNPLPSLDTAIQEIIFEETRLNL 91