BLASTX nr result
ID: Anemarrhena21_contig00058416
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00058416 (283 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella comp... 69 9e-10 gb|KDQ05630.1| hypothetical protein BOTBODRAFT_122479, partial [... 47 2e-07 ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipol... 47 6e-07 gb|KIJ93785.1| hypothetical protein K443DRAFT_377952, partial [L... 57 4e-06 >dbj|GAO47202.1| hypothetical protein G7K_1412-t1 [Saitoella complicata NRRL Y-17804] Length = 214 Score = 69.3 bits (168), Expect = 9e-10 Identities = 40/82 (48%), Positives = 47/82 (57%) Frame = +1 Query: 1 IPINHYGEFRNQQNKDARPILLFHANVFGRKPALNTLIFSK*KSWLIDTPNEGHADPPRG 180 IPINHYG RNQQN+ RPILLFHANVF + PALNTLIFS K Sbjct: 81 IPINHYGGPRNQQNRTTRPILLFHANVFEQMPALNTLIFSNQK----------------- 123 Query: 181 KLPSRPVHTKKADRQTEAEVRL 246 + P R ++ADR T ++ L Sbjct: 124 ERPGRVSSHREADRPTRPKLEL 145 >gb|KDQ05630.1| hypothetical protein BOTBODRAFT_122479, partial [Botryobasidium botryosum FD-172 SS1] gi|646295020|gb|KDQ16185.1| hypothetical protein BOTBODRAFT_107195, partial [Botryobasidium botryosum FD-172 SS1] Length = 76 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 25/53 (47%), Positives = 27/53 (50%) Frame = +2 Query: 125 KSPG*STHPTKGMPTHQEVSFHQDQYTPKRRTGRQKPKFDYELFNGSNFNIRY 283 K PG THP KGMP HQE F+YELFN +NFNIRY Sbjct: 25 KRPGSPTHPVKGMPAHQE--------------------FNYELFNCNNFNIRY 57 Score = 34.7 bits (78), Expect(2) = 2e-07 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = +1 Query: 1 IPINHYGEFRNQQNKDAR 54 +PINHYG+ RNQQN+ AR Sbjct: 7 VPINHYGDSRNQQNRTAR 24 >ref|XP_007718977.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] gi|477581303|gb|ENH98510.1| hypothetical protein COCC4DRAFT_155570 [Bipolaris maydis ATCC 48331] gi|576911966|gb|EUC26718.1| hypothetical protein COCCADRAFT_42279 [Bipolaris zeicola 26-R-13] Length = 68 Score = 47.0 bits (110), Expect(2) = 6e-07 Identities = 22/40 (55%), Positives = 29/40 (72%) Frame = +1 Query: 1 IPINHYGEFRNQQNKDARPILLFHANVFGRKPALNTLIFS 120 +P+NH G RNQQN++ARPILLFHAN P+ N +F+ Sbjct: 5 VPVNHCGVSRNQQNRNARPILLFHAN---PDPSFNYELFN 41 Score = 33.1 bits (74), Expect(2) = 6e-07 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +2 Query: 233 PKFDYELFNGSNFNIRY 283 P F+YELFN +NFNIRY Sbjct: 33 PSFNYELFNCNNFNIRY 49 >gb|KIJ93785.1| hypothetical protein K443DRAFT_377952, partial [Laccaria amethystina LaAM-08-1] Length = 117 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 137 NQDFYFEKIRVFKAGFRPNTLAWNNRIGR 51 NQDFY EKIRVFKAG PNTLAWNN+IGR Sbjct: 73 NQDFYLEKIRVFKAGICPNTLAWNNKIGR 101