BLASTX nr result
ID: Anemarrhena21_contig00058082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00058082 (366 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008803106.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_010937577.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >ref|XP_008803106.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Phoenix dactylifera] Length = 547 Score = 60.1 bits (144), Expect = 6e-07 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = +2 Query: 239 LSATPYSFVQILSSASKSFALSTGQQSHSCILKLGLNSNLFI 364 LSA PY FV+ILS+A+KS +LSTG+Q+H+ ++KLGL SNLFI Sbjct: 47 LSAAPYDFVRILSAAAKSSSLSTGKQTHTAVIKLGLASNLFI 88 >ref|XP_010937577.1| PREDICTED: pentatricopeptide repeat-containing protein At1g11290-like [Elaeis guineensis] Length = 612 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = +2 Query: 239 LSATPYSFVQILSSASKSFALSTGQQSHSCILKLGLNSNLFI 364 L A PY FV+ILS+A+KS +++TGQQ+H+ ++KLGL SNLFI Sbjct: 48 LRAAPYDFVRILSAAAKSSSIATGQQTHTAVIKLGLASNLFI 89