BLASTX nr result
ID: Anemarrhena21_contig00057932
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00057932 (296 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO39380.1| hypothetical protein CISIN_1g044502mg [Citrus sin... 57 6e-06 ref|XP_006484187.1| PREDICTED: 14-3-3-like protein GF14 iota-lik... 57 6e-06 ref|XP_006437949.1| hypothetical protein CICLE_v10033402mg [Citr... 57 6e-06 >gb|KDO39380.1| hypothetical protein CISIN_1g044502mg [Citrus sinensis] Length = 262 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 295 STLIMQLLRDNLTLWTSDIPEDGGNV*FEAQD 200 STLIMQLLRDNLTLWTSD+PEDGG F+A+D Sbjct: 221 STLIMQLLRDNLTLWTSDLPEDGGEDNFKAED 252 >ref|XP_006484187.1| PREDICTED: 14-3-3-like protein GF14 iota-like [Citrus sinensis] Length = 261 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 295 STLIMQLLRDNLTLWTSDIPEDGGNV*FEAQD 200 STLIMQLLRDNLTLWTSD+PEDGG F+A+D Sbjct: 221 STLIMQLLRDNLTLWTSDLPEDGGEDNFKAED 252 >ref|XP_006437949.1| hypothetical protein CICLE_v10033402mg [Citrus clementina] gi|557540145|gb|ESR51189.1| hypothetical protein CICLE_v10033402mg [Citrus clementina] Length = 311 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 295 STLIMQLLRDNLTLWTSDIPEDGGNV*FEAQD 200 STLIMQLLRDNLTLWTSD+PEDGG F+A+D Sbjct: 221 STLIMQLLRDNLTLWTSDLPEDGGEDNFKAED 252