BLASTX nr result
ID: Anemarrhena21_contig00057668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00057668 (223 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIZ68148.1| WD repeat-containing protein 74-like isoform [Orn... 65 2e-08 >gb|AIZ68148.1| WD repeat-containing protein 74-like isoform [Ornithogalum saundersiae] Length = 461 Score = 64.7 bits (156), Expect = 2e-08 Identities = 36/60 (60%), Positives = 37/60 (61%) Frame = -2 Query: 201 LIVLLMCTEKGKXXXXXXXXXXXSPDSTITDSQSTWDVCAAGKVICSAVNAIEKYASLGG 22 L VLL CTEKGK S DS DSQSTWDVC AGKVI S+V A EKYA GG Sbjct: 124 LNVLLTCTEKGKAKLTSVAMADPSSDSATPDSQSTWDVCVAGKVIWSSVAAHEKYALFGG 183