BLASTX nr result
ID: Anemarrhena21_contig00057629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00057629 (234 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAD36201.1| putative Nit protein 2 [Oryza sativa Japonica Gr... 60 6e-07 ref|NP_001057093.1| Os06g0206000 [Oryza sativa Japonica Group] g... 60 6e-07 gb|ERN11201.1| hypothetical protein AMTR_s00024p00215830 [Ambore... 59 1e-06 gb|EMS49913.1| Omega-amidase NIT2 [Triticum urartu] 59 2e-06 ref|XP_010227881.1| PREDICTED: omega-amidase,chloroplastic-like ... 56 8e-06 >dbj|BAD36201.1| putative Nit protein 2 [Oryza sativa Japonica Group] Length = 237 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 172 LHLFDVDIPRDITFRESDTFTAGAEPTIVDT 80 LHLF++DIP DITFRESDTFTAG EPTIVDT Sbjct: 93 LHLFEIDIPGDITFRESDTFTAGQEPTIVDT 123 >ref|NP_001057093.1| Os06g0206000 [Oryza sativa Japonica Group] gi|113595133|dbj|BAF19007.1| Os06g0206000 [Oryza sativa Japonica Group] gi|125554477|gb|EAZ00083.1| hypothetical protein OsI_22087 [Oryza sativa Indica Group] gi|125596425|gb|EAZ36205.1| hypothetical protein OsJ_20521 [Oryza sativa Japonica Group] Length = 287 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 172 LHLFDVDIPRDITFRESDTFTAGAEPTIVDT 80 LHLF++DIP DITFRESDTFTAG EPTIVDT Sbjct: 93 LHLFEIDIPGDITFRESDTFTAGQEPTIVDT 123 >gb|ERN11201.1| hypothetical protein AMTR_s00024p00215830 [Amborella trichopoda] Length = 247 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/48 (62%), Positives = 36/48 (75%), Gaps = 5/48 (10%) Frame = -3 Query: 208 SCC*YDFD---VAIH--LHLFDVDIPRDITFRESDTFTAGAEPTIVDT 80 SCC + D +A H +HLFD+D+P DITFRESDT TAG +PTIVDT Sbjct: 58 SCCIFGSDGLLMAKHRKVHLFDIDVPGDITFRESDTLTAGEKPTIVDT 105 >gb|EMS49913.1| Omega-amidase NIT2 [Triticum urartu] Length = 243 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 172 LHLFDVDIPRDITFRESDTFTAGAEPTIVDT 80 LHLF +DIP DITFRESDTFTAG EPT+VDT Sbjct: 66 LHLFGIDIPGDITFRESDTFTAGQEPTVVDT 96 >ref|XP_010227881.1| PREDICTED: omega-amidase,chloroplastic-like [Brachypodium distachyon] Length = 250 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -3 Query: 172 LHLFDVDIPRDITFRESDTFTAGAEPTIVDT 80 LHLF +DIP DITFRESDT TAG EPT+VDT Sbjct: 68 LHLFGIDIPGDITFRESDTLTAGQEPTVVDT 98