BLASTX nr result
ID: Anemarrhena21_contig00057529
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00057529 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP00842.1| unnamed protein product [Coffea canephora] 57 6e-06 >emb|CDP00842.1| unnamed protein product [Coffea canephora] Length = 566 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 3/79 (3%) Frame = -1 Query: 233 DELFAEGLSLRKWATE---HSILAVIERNVLEREVMGDQVVATQEEKYLNIKSQCLSSII 63 DE+F E LSLR+W + S++ VI+R++L E +++V T K C+SS++ Sbjct: 481 DEMFTEALSLRRWVQDCLPDSVIQVIDRDLLHPE---NELVQT--------KINCISSVL 529 Query: 62 ELGLLCSNESEKERISMKD 6 +LGL C+ ++ KERI MK+ Sbjct: 530 QLGLSCTTDAPKERIDMKE 548