BLASTX nr result
ID: Anemarrhena21_contig00057369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00057369 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJB16632.1| hypothetical protein B456_002G240600 [Gossypium r... 57 6e-06 >gb|KJB16632.1| hypothetical protein B456_002G240600 [Gossypium raimondii] Length = 96 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 1/52 (1%) Frame = -1 Query: 184 DELFEISLKVLNDIPPPKYYEHQLT-TKEALFANCLLPTQCICAAIPIESSN 32 +ELFEI+++ +N IPPP Y+E T T AL ANCLLP + AIP+ SSN Sbjct: 35 EELFEINIEAVNSIPPPHYWEAFFTATSNALLANCLLPISDLSTAIPMVSSN 86