BLASTX nr result
ID: Anemarrhena21_contig00057319
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00057319 (306 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008798293.1| PREDICTED: ethylene-responsive transcription... 72 2e-10 ref|XP_010924382.1| PREDICTED: ethylene-responsive transcription... 69 9e-10 ref|XP_010918971.1| PREDICTED: ethylene-responsive transcription... 62 2e-07 >ref|XP_008798293.1| PREDICTED: ethylene-responsive transcription factor 1B [Phoenix dactylifera] Length = 272 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/61 (60%), Positives = 45/61 (73%), Gaps = 2/61 (3%) Frame = +1 Query: 130 QASQRLLENVWTNFICG-AQESCNSNEELNKIPVASQTWQELPHQE-GNGNLAVLQRLPS 303 +A+ +LLENVW +F G A ESC+SN+E NK P S+ W E+P E G GNLAVLQRLPS Sbjct: 9 EANDKLLENVWASFFAGNAPESCSSNDEPNKKPEDSRDWNEMPRLEGGEGNLAVLQRLPS 68 Query: 304 L 306 L Sbjct: 69 L 69 >ref|XP_010924382.1| PREDICTED: ethylene-responsive transcription factor ERF091-like [Elaeis guineensis] Length = 258 Score = 69.3 bits (168), Expect = 9e-10 Identities = 37/61 (60%), Positives = 44/61 (72%), Gaps = 2/61 (3%) Frame = +1 Query: 130 QASQRLLENVWTNFICG-AQESCNSNEELNKIPVASQTWQELPHQE-GNGNLAVLQRLPS 303 +A+ RLLENVW +F G A ESC+SN+E NK S+ W E+P E G GNLAVLQRLPS Sbjct: 9 EANDRLLENVWASFFAGNAPESCSSNDEPNKKSADSRDWNEMPCLEGGEGNLAVLQRLPS 68 Query: 304 L 306 L Sbjct: 69 L 69 >ref|XP_010918971.1| PREDICTED: ethylene-responsive transcription factor 1B [Elaeis guineensis] Length = 272 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/61 (50%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = +1 Query: 127 TQASQRLLENVWTNFICGAQESCNSNEELNKIPVASQTWQELPHQE-GNGNLAVLQRLPS 303 ++ + +LL++VW +FI G S S++E +K ASQ W E+PH E G NLAVLQRLPS Sbjct: 8 SETNDKLLQSVWASFITGGAPSSCSSDESHKKHAASQEWNEMPHLEGGEENLAVLQRLPS 67 Query: 304 L 306 L Sbjct: 68 L 68