BLASTX nr result
ID: Anemarrhena21_contig00057294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00057294 (542 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006388326.1| hypothetical protein POPTR_0228s002002g, par... 59 1e-06 >ref|XP_006388326.1| hypothetical protein POPTR_0228s002002g, partial [Populus trichocarpa] gi|550310006|gb|ERP47240.1| hypothetical protein POPTR_0228s002002g, partial [Populus trichocarpa] Length = 691 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/57 (47%), Positives = 41/57 (71%) Frame = -2 Query: 355 LRKLCSYYSRRRHINVKFHFIYKVLEDEEVMSEKVVGSKNVVDIFTEVVNREK*DLC 185 L K +++SR +HI +K+HFI ++L+DE++M EKV GSKN D+ T+ V +K LC Sbjct: 109 LAKNPAFHSRTKHIQIKYHFIRQLLDDEQLMLEKVCGSKNPTDMLTKGVTLDKLKLC 165