BLASTX nr result
ID: Anemarrhena21_contig00056920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Anemarrhena21_contig00056920 (713 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010923371.1| PREDICTED: ubiquitin-conjugating enzyme E2 Z... 62 3e-07 ref|XP_010276326.1| PREDICTED: constitutive photomorphogenesis p... 58 6e-06 >ref|XP_010923371.1| PREDICTED: ubiquitin-conjugating enzyme E2 Z-like [Elaeis guineensis] Length = 392 Score = 62.0 bits (149), Expect = 3e-07 Identities = 47/121 (38%), Positives = 60/121 (49%) Frame = -2 Query: 445 PFRFQPQV*VTLKS*ICCHNVGFCWQCKSTHFKDGWSHALTLSKMSVSVKAIFPNPDP*L 266 PFR PQV T K+ I NV KDGWS ALT+S + +++KAI NPDP Sbjct: 95 PFR-PPQV--TFKTRIFHCNVDSTGNLNLDILKDGWSPALTISNVLLTIKAIITNPDP-- 149 Query: 265 T*RF*QMCILSLIWQLLVSGIPH*HLISRAKHNEIAEEFAMHFFLVNCHLSDHC*VTHCP 86 ++ LVS I +L RAKH+EIA E+ M F V + +H T C Sbjct: 150 -------------YKPLVSSIACLYLTDRAKHDEIAAEWTMRFARVRTLVFEHEHSTFCE 196 Query: 85 A 83 A Sbjct: 197 A 197 >ref|XP_010276326.1| PREDICTED: constitutive photomorphogenesis protein 10-like [Nelumbo nucifera] Length = 188 Score = 57.8 bits (138), Expect = 6e-06 Identities = 32/71 (45%), Positives = 42/71 (59%) Frame = -2 Query: 349 KDGWSHALTLSKMSVSVKAIFPNPDP*LT*RF*QMCILSLIWQLLVSGIPH*HLISRAKH 170 KDGWS ALT+SK+ +++++IF NPDP LVSGI +L RAKH Sbjct: 131 KDGWSPALTISKVLLAIRSIFSNPDPNTP---------------LVSGIARLYLTDRAKH 175 Query: 169 NEIAEEFAMHF 137 +EIA E+ M F Sbjct: 176 DEIAAEWTMRF 186